KEGG   Lotus japonicus: Lj0g3v0257919.1Help
Entry
Lj0g3v0257919.1   CDS       T04348                                 

Gene name
Lj0g3v0257919.1
Definition
(Kazusa) -
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lja01001]
    Lj0g3v0257919.1 (Lj0g3v0257919.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase WAK_assoc
Motif
AA seq 257 aa AA seqDB search
MFNISYNPFDFQTDQDYILRLTWSKPNCQQCESKGRRCGWRNHTANNQIYCFPNHKGSST
ALVTTGSVLGSLFFMLLTAAVYHVYDIYRLRKEKEAIFEKFLQDYRALKPTRYSYVEIKR
ITNNFEHKLGEGAFGTVFKGSISKEIPIAVKILNISHGKGEEFINEVSTMGRIHHVNIVR
MVGFCADGFNRALVYEFLPNGSLQKFINSPDNRQNFLGWKRLHEIALGIAKGIEYLHQGC
NQRILHFDIKPQNVLLD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatatttcttacaacccttttgattttcaaactgatcaggactatattcttcgc
ttgacatggtctaagcccaactgtcaacaatgcgaatcaaaagggagaagatgtgggtgg
aggaatcatactgccaacaatcaaatatattgtttccccaatcacaaaggttcttcaaca
gctctagtgactacaggatctgtcctaggatccttgttctttatgctcttgactgctgca
gtctaccacgtctatgacatttaccgactgagaaaagaaaaagaagcaatattcgaaaaa
ttcctacaagactacagagctcttaagcccaccagatactcttatgtcgaaattaagaga
atcaccaacaattttgagcacaagttaggagagggagcctttggaaccgtgtttaaagga
agcatttccaaagaaattcctattgctgtgaagatcttgaatatttctcacggaaagggg
gaagaattcattaatgaagttagcaccatgggtagaatccaccatgttaacattgttcgc
atggtgggtttctgtgctgatggctttaatagagctcttgtatatgaattcttaccaaac
ggttcactccagaagttcatcaattcaccagacaacaggcaaaacttccttggttggaaa
agacttcatgaaattgctttaggaatagccaagggaattgagtatcttcaccaaggttgt
aatcagcgcattctccactttgatatcaagcctcaaaatgtgttgctagac

DBGET integrated database retrieval system