KEGG   Lotus japonicus: Lj0g3v0274549.2Help
Entry
Lj0g3v0274549.2   CDS       T04348                                 

Gene name
Lj0g3v0274549.2
Definition
(Kazusa) -
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lja  Lotus japonicus
Pathway
lja00010  Glycolysis / Gluconeogenesis
lja00053  Ascorbate and aldarate metabolism
lja00071  Fatty acid degradation
lja00280  Valine, leucine and isoleucine degradation
lja00310  Lysine degradation
lja00330  Arginine and proline metabolism
lja00340  Histidine metabolism
lja00380  Tryptophan metabolism
lja00410  beta-Alanine metabolism
lja00561  Glycerolipid metabolism
lja00620  Pyruvate metabolism
lja00903  Limonene and pinene degradation
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00053 Ascorbate and aldarate metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00620 Pyruvate metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00561 Glycerolipid metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00310 Lysine degradation
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00330 Arginine and proline metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00340 Histidine metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
   00380 Tryptophan metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Lj0g3v0274549.2 (Lj0g3v0274549.2)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Lj0g3v0274549.2 (Lj0g3v0274549.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Spore_III_AB GerD FadA
Motif
AA seq 476 aa AA seqDB search
MYNMEYSLESLEKVLKSMRKYYGSGKTKEASWRESQLKGLHNFLMEREDEIFKALKQDLG
KHQVEAFRDEIGTLIKSLNLATKSLKKWMEGKEAKLPKIALLSSAEIVPEPLGLVLIISS
WNFPFGLSLEPLIGAVAAGNIVVLKPSEISPACSTLLANVLPTYLDGNAIKVVHGGPEVG
EQLLKQRWDKIFFTGSARVGRIVMSAAVEHLTPVTLELGGKCPALIDSLAASWDREVAVK
RILVAKYGACAGQACISIDYILVEKSFSSILVGLMKVWIKKMFGENPKASNTIARIVNKE
HFLRLKHLLTDPEIKESVVFGGSLDEDDLFIEPTILLDPPLESAIMSEEIFGPLLPIITV
EKIEDSIEFISSRPKPLAIYAFTKNKTLQYAADTLPFGGVGECGFGKYHGKFSFDAFSHH
KAVARRSFYTDFWFRFPPWNLNKLQLLEVAYNLDYLGMLLVLLGLKRSKRSLFQAC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacatggagtactcactggaatctttggagaaagttctgaagagcatgaggaag
tattatgggagtggaaaaacaaaggaagcatcatggagagaatcacagcttaaagggttg
cataatttcctcatggaaagagaggatgaaatcttcaaggccctcaagcaggatttaggg
aaacatcaagttgaggcttttagagatgagattggaactttaatcaagtccttgaatttg
gcaacaaagtctctcaaaaaatggatggaaggcaaagaggctaaactgcccaaaatagca
ctactctccagtgcagaaattgttcctgagcctcttggtcttgttctcataatctcatca
tggaattttccttttggactgtccttggagccactgattggagctgtagcagctggaaac
attgtggttctgaagccttcagagatttcccctgcttgttccactcttctagccaatgtc
cttccaacttacttggatggtaatgccattaaggtcgtccatggtggaccagaagtgggc
gagcaactcctcaaacaaagatgggataagatatttttcacaggaagtgctcgggtgggg
aggattgttatgtctgcagcagtggagcatctgacacctgtgactttggaattaggtgga
aaatgtccagcattaattgattcccttgcagcttcttgggacagagaggtggctgtgaag
cgaattttggtggcaaaatatggggcttgtgcaggacaagcatgcatatcaatcgattat
atcctcgtagaaaagagtttcagttctatattggtgggattaatgaaagtatggatcaag
aaaatgtttggtgaaaacccaaaagcatccaacacaattgcaaggattgttaataaagaa
cattttttgagactcaagcatcttctcactgatcctgagatcaaagaatcagtggttttt
ggtggttcattggatgaagatgacttgtttattgagccaacaatactattggatccgcca
cttgaatcagcaatcatgtcagaagaaatctttggtcccctgcttccaatcatcactgta
gagaagattgaagacagtattgaattcatatcatcaaggccaaaacctctagcaatttat
gcctttacaaaaaacaaaactctgcagtatgcagctgatactctcccatttggaggagtt
ggtgaatgtggatttggcaagtaccacgggaagttctcctttgatgcgttcagccaccat
aaggctgttgcaagaagaagcttctacactgatttttggttcagatttcctccatggaat
cttaacaagctccaactactggaggtagcttacaatttggactatcttggaatgcttctt
gtcctgctcggcttaaagagatcaaaacgctcattatttcaggcttgttga

DBGET integrated database retrieval system