KEGG   Lotus japonicus: Lj0g3v0308209.2Help
Entry
Lj0g3v0308209.2   CDS       T04348                                 

Gene name
Lj0g3v0308209.2
Definition
(Kazusa) -
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
lja  Lotus japonicus
Pathway
lja00340  Histidine metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Lj0g3v0308209.2 (Lj0g3v0308209.2)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Lj0g3v0308209.2 (Lj0g3v0308209.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
AA seq 207 aa AA seqDB search
MENSTEKNVTISLNIPQVRDSNESPRVVSNAKPFGEEEKHKELPENNGHMICLPINSTGE
TQANLAQVIAHYVGTLNKKQLRFLGYSTNQEFDYDALAPLLHFHINNAGDPFIGSSYSLN
SVEFEVPVLDWFANLWEIEKEEYWGYVTTGGTEGNLYGILSGREQFPNGILYTSQDSHYS
IFKTAKMYRMQCIKVGTLISGEINQLC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggagaattcaacagagaagaacgtgacaatatctttaaacattccacaagttcgtgac
agtaatgagtctcctagggtggtcagcaatgctaagccctttggagaagaagagaagcat
aaagaacttccagagaataatgggcatatgatctgtcttcccatcaacagcactggagag
acgcaagcgaatttggctcaagtaattgcccattatgttgggaccctaaataaaaaacaa
ttgcgctttttaggttattccactaatcaagaatttgactatgacgcattagcaccatta
ttgcattttcacataaacaatgctggcgacccatttatagggagtagttatagtctaaat
tcagtggaatttgaagtacccgtgcttgattggtttgccaatctgtgggagatagagaaa
gaggagtattggggatacgtcacaactggtggaacagagggaaacctttatgggatatta
tctgggagggaacaattcccaaatggaattttgtacacatcgcaagactcgcattattca
atattcaagactgcaaaaatgtatagaatgcaatgcataaaagttggcactttgatctcc
ggtgagatcaatcaattatgttga

DBGET integrated database retrieval system