KEGG   Lotus japonicus: Lj1g3v0296890.1Help
Entry
Lj1g3v0296890.1   CDS       T04348                                 

Gene name
Lj1g3v0296890.1
Definition
(Kazusa) -
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lja01001]
    Lj1g3v0296890.1 (Lj1g3v0296890.1)
   01009 Protein phosphatases and associated proteins [BR:lja01009]
    Lj1g3v0296890.1 (Lj1g3v0296890.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Lj1g3v0296890.1 (Lj1g3v0296890.1)
Protein kinases [BR:lja01001]
 Serine/threonine kinases: Other
  Wnk family
   Lj1g3v0296890.1 (Lj1g3v0296890.1)
Protein phosphatases and associated proteins [BR:lja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lj1g3v0296890.1 (Lj1g3v0296890.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
AA seq 640 aa AA seqDB search
MPPDSPELDDDPEIEFAEIDPTGRYGRYKEILGKGAFKKVYRAFDELEGIEVAWNQVKVA
DLLRNSEDLERLYSEVHLLKTLKHKNIIKFYSSWVDAKNENINFITEIFTSGTLRQYRKK
HKHVDLRALKKWSRQILEGLSYLHSHNPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAIL
QQASSAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLELVTFEYPYIECANAAQIYKK
VTSGIKPASLAKVIDIEVKSFIEKCIANVSERLPAKDLLVDPFLLSDYDGESVGRSSRAG
TLHSENNCDNQPIGESTEDNSVETREFTVEGQRRDVNTIFLKLRIADPSGSIRNIHFPFD
VGADTSISVAGEMVEQLELTDQDVSAIANMIDSEIQYHIPSWNPSETPVSRHEASPMAND
SVTSTGSLALEILPSGRKYWSDSPRALGGSSPLRHGPSNLSNEGDVSAREGSLTESGTDK
ECDGAADSPFSERSIASECLERTSEKSSPEELQHVASDLSNEGDVSAKEGSMAESSADKE
CDGAADSPFSERSVASECLERTSEKSSPEEISGSLEDSEIESIDKIAKDLECLLVMQRVE
LDELKRKHKLAVSDLLKELSPEMCQKVQNICNLEIPDSEM
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggattccccggagctagacgacgatcccgaaattgagttcgccgagattgat
cccaccggtcgttatggtcggtacaaggaaattttaggaaaaggggctttcaagaaagta
taccgagcgtttgatgagttggaaggaattgaagtggcttggaatcaggttaaggtggct
gatctattgcgtaactctgaagatttagagcgcctttattcagaagtgcatttgctcaag
actttgaagcataagaatataattaaattttacagttcgtgggttgacgctaagaatgag
aacattaacttcattactgaaattttcacctcaggaacattgcgccaataccggaagaaa
cataagcatgttgacttgagagctttgaagaaatggtccaggcagattttggagggcctt
tcgtatcttcacagtcataatccaccagttattcaccgagaccttaagtgtgacaacatt
tttgtcaatgggaatcaaggggaggtgaaaattggtgatttaggattggcggccatcctt
caacaggccagttcagctcacagtgtcataggaaccccagagttcatggcccctgaactt
tatgaagaggaatacaacgagcttgttgacatctatgcttttggcatgtgcttgttggag
ttggtcacctttgagtatccatatattgaatgtgccaatgctgctcaaatatacaagaaa
gtgacttctggaataaagccagcatcattggccaaagttatagatattgaagttaaatca
tttatagaaaagtgtattgctaatgtatcagaacgcttacctgcaaaggatctcttggtg
gatcccttccttctgtcagattatgacggtgaaagtgtaggtcgatcttcaagagctgga
acccttcattcagaaaataattgtgataatcaacccattggagaaagtaccgaggataat
tctgttgagactagggaattcactgtggaaggacagaggagagatgttaatacaatattt
ttaaaactgcgaattgcagatccctcaggttctattcgcaatatacacttcccttttgat
gttggagcagacacttctatctctgttgctggtgaaatggttgagcagttggaacttact
gatcaagatgtttcggctattgctaacatgatcgactcagaaattcagtatcacattcct
agttggaatcctagtgaaactcctgtaagtaggcatgaggcttctcctatggcaaatgat
tctgtcacttctactggcagtcttgctttagaaatattaccttcaggtcgtaagtactgg
tcagactcaccaagggcattaggtggaagctctccattgcggcacggaccttcaaactta
tctaatgaaggggatgtgagtgctagggaaggaagcttgactgaaagtggtactgataag
gaatgtgatggagctgctgattcccctttcagtgaaagaagtattgcatcggagtgttta
gaaagaaccagtgaaaaatcttctccggaagaattgcagcacgttgcttcagacttatct
aatgaaggggatgtgagtgctaaggaaggaagcatggctgaaagtagtgctgataaggaa
tgtgatggagctgctgattccccttttagtgaaagaagtgttgcatcggagtgtttagaa
agaaccagtgaaaaatcttctccggaagaaatatcgggaagcttggaagattctgaaata
gaatccatcgataaaatagcaaaagatctggaatgtttgttggttatgcaaagagtggag
cttgatgaactaaagaggaaacacaaattagctgtgtcagatcttttgaaggaactttct
ccagaaatgtgccaaaaggtccaaaatatatgtaacctggagattcctgacagtgaaatg
taaggt

DBGET integrated database retrieval system