KEGG   Lotus japonicus: Lj1g3v0395830.1Help
Entry
Lj1g3v0395830.1   CDS       T04348                                 

Gene name
Lj1g3v0395830.1
Definition
(Kazusa) -
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lja  Lotus japonicus
Pathway
lja00020  Citrate cycle (TCA cycle)
lja00640  Propanoate metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lj1g3v0395830.1 (Lj1g3v0395830.1)
   00640 Propanoate metabolism
    Lj1g3v0395830.1 (Lj1g3v0395830.1)
Enzymes [BR:lja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Lj1g3v0395830.1 (Lj1g3v0395830.1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lj1g3v0395830.1 (Lj1g3v0395830.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
AA seq 455 aa AA seqDB search
MEALEAELDLVVCITEGIPQHDMVRVKAAINRQSKTRLIGPNCPGIIKPGECKIGIMPGY
IHKPGRIGIISRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLKKFLSDPQT
EGIVLIGEIGGTAEEYAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGVSVPALNRLCS
CCDSSPLLLRHYQGVVGEVEKILRAFIWGKDDNGVKKAWIPWTMICQFQESAMIDRRKCS
PILQNIINVLSEEALLSKRFKESLHLRSPVWSPPPNGIMKINVDGASQGSLGPSGIWGVP
RNSSNQDENNSKVHHPYHQNLLPFKLLLLPMDSVSYPHNWPDKPPNLAQMFNANMTKQRM
ASILHVVEALQHISAKINNFAHMPFHDPQYQPHPNRRMILNLPRYFCIQEAKSLYLAIDK
AVCASPAAQLAHLLLLVPAPAPWWCCWLSWKRSQS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaggccttggaggctgagttggatctcgttgtttgcatcactgaaggcatcccccaa
catgatatggtgcgagttaaagcagcgattaacagacagtcgaaaactcgtctgatagga
ccaaactgccctggtatcatcaagcctggggaatgtaaaatcggaatcatgccgggttac
attcataagcctgggcgcattggaattatttctcgttctgggactttgacgtatgaggcg
gttttccaaacgtctgctgttggccttggacaatccacttgtgtgggtatcggaggagat
ccctttaatggaacaaattttgttgattgccttaagaaattcctatcagatcctcagaca
gaaggtatcgttcttataggagagataggtggaactgcagaagagtatgctgctgcacta
attaaggaaagcggaactgagaagcctattgttgcatttattgctggattaactgctccc
cctggccgccgtatgggtcatgctggagtttccgttcctgctttgaatcgactctgctcc
tgctgtgactcatcgccgctcctgcttcgacactatcaaggcgtggtaggtgaggttgag
aaaatccttagagcttttatttggggtaaagatgacaatggggtgaagaaagcatggatc
ccgtggactatgatttgccaattccaagagtcagccatgattgataggagaaaatgttcc
ccaatcctacaaaacataatcaatgtgttaagtgaggaagctttgttgtcaaagaggttt
aaagagagcctgcatcttcgttcaccagtttggtcccctccgcccaatggtattatgaaa
atcaatgtagatggggcttctcaagggagccttggcccaagtgggatatggggtgtccca
agaaactccagtaatcaggatgagaacaattccaaagttcatcatccataccatcaaaac
cttcttccattcaagcttcttcttcttcccatggattctgtgagctatcctcacaattgg
cctgataagccgcctaatctagctcaaatgttcaacgccaacatgacaaagcaaagaatg
gcttcaattctgcatgtggtagaagcgctgcaacacatcagcgccaagatcaataacttc
gcgcacatgccctttcatgaccctcaatatcaaccacatccgaataggaggatgattctg
aatcttcctcgatacttttgtatccaggaagccaagagtctgtacctggctattgacaag
gcggtgtgtgcatcaccagctgctcaactcgcacatttgctattgctggtccctgctccc
gccccatggtggtgctgttggttgagctggaagaggtcgcagagttaa

DBGET integrated database retrieval system