KEGG   Lotus japonicus: Lj1g3v1478280.1Help
Entry
Lj1g3v1478280.1   CDS       T04348                                 

Gene name
Lj1g3v1478280.1
Definition
(Kazusa) -
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lja  Lotus japonicus
Pathway
lja00260  Glycine, serine and threonine metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lj1g3v1478280.1 (Lj1g3v1478280.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Lj1g3v1478280.1 (Lj1g3v1478280.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
AA seq 146 aa AA seqDB search
MPRLKHRRDKALGVPVDRLVQAADSVLARRLRKTLGGGMRQIGILCAAALVGLHENVGKL
KSDHKNARTLADGLSEILGLKVDASSVESNMIFIGIEDSWTTAEKICKYLEERGILLIKE
SSSRQVRAAHRMGTNIIRTQVRILNL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgccgagactcaagcatcgcagagacaaggcacttggtgttcctgtggataggcttgtc
caagctgctgattcggttttagctagacgtctccggaaaacgttgggtggtgggatgagg
cagattggcatcctttgtgctgctgcacttgttgggttacatgaaaatgttggaaagctg
aaaagtgatcacaagaatgctagaactttggccgatggactgagtgaaattttaggactc
aaagtcgatgccagttctgtggagagcaatatgatatttattggaattgaagattcatgg
actacagcagaaaagatatgcaagtacttggaagaacgtggtatccttctgataaaagag
agctcatcaaggcaagttagagctgctcatagaatgggtacaaatatcattcgtactcag
gtacgcatactaaacctg

DBGET integrated database retrieval system