KEGG   Lotus japonicus: Lj1g3v3218140.1Help
Entry
Lj1g3v3218140.1   CDS       T04348                                 

Gene name
Lj1g3v3218140.1
Definition
(Kazusa) -
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lja  Lotus japonicus
Pathway
lja03040  Spliceosome
lja04141  Protein processing in endoplasmic reticulum
lja04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lja00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lja01009]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lja03041]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
   03009 Ribosome biogenesis [BR:lja03009]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
   03110 Chaperones and folding catalysts [BR:lja03110]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
   04131 Membrane trafficking [BR:lja04131]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
   03051 Proteasome [BR:lja03051]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
   03029 Mitochondrial biogenesis [BR:lja03029]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lja04147]
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Protein phosphatases and associated proteins [BR:lja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Lj1g3v3218140.1 (Lj1g3v3218140.1)
Spliceosome [BR:lja03041]
 Complex B
  Other components
   Prp19 complex
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
 Complex C
   Prp19-CDC5 complex
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Ribosome biogenesis [BR:lja03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Chaperones and folding catalysts [BR:lja03110]
 Heat shock proteins
  HSP70 / DNAK
   Lj1g3v3218140.1 (Lj1g3v3218140.1)
Membrane trafficking [BR:lja04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Proteasome [BR:lja03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Mitochondrial biogenesis [BR:lja03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Lj1g3v3218140.1 (Lj1g3v3218140.1)
Exosome [BR:lja04147]
 Exosomal proteins
  Proteins found in most exosomes
   Lj1g3v3218140.1 (Lj1g3v3218140.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 TIR NB-ARC MreB_Mbl TIR_2 AAA_14 ATPase_2 AAA_22 KAP_NTPase Pox_A32 NACHT ABC_tran AAA_16 AAA_7 AAA_30 cobW
Motif
AA seq 967 aa AA seqDB search
MAGKGEGATIGIDLGTTYSCVGVWQNDGVEIITNDQGNRTTPSYVAFTDSERLIGDDAKN
QVTINPTNTVFDAKRLIGRKFSDASVQSDMKLWPFKVIHGPGDKPMIVVNYKNEEKQFTA
EEISSMVLLKMRKIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVIRIINEP
TAAALAYGLDMGPTGDDEKNVLIFDLGGGTFDVTLLIIDSSVFDVKATSGDTHLGGEDFD
NRMVNYFVEEFKRKHNKDISEDPRALRRLRNACEKAKRTLSSTEQTTIAIDSLYEGVDLY
TAITRDRFEELNMDLFKKCMETVEKCLRDAEMEKSDIHDVVLVGGSTRIPKVQSMLQGFF
NGKELCKSINPDVAVAYGASVQAAKLSGEKNNEIKDLVLLDVTPLSLGVETVGGVMTVLI
PRNFTIPARKEQIFSTYSDNQPGVLIKVYEGEKTRSTENNLLGKFELSGIPPAPSGVPKI
NVCFEIDSNGILNVSAEDKTTGKKNKITITNDKGRLSKEEIEKMVQEAEKYNSTKDAPYL
RLEAQVEHDTCHQITVPTPSLQSFPSGNFRYYFNSTKEASQKLKVALKDDNFYVIGLHGK
RGSGKTTLLKDKIEEYETIFHKVIFLPVSENQDTKSIQEEFAKTLNVFEKHDTDAVRIMK
IILALERKDRTTLVILDNFPSKSKLQELGIPYNSKQYKFLLTARDETDCIFMGCDHSISL
DPLSNDEAFTLLRKLSGVNSQSALFEVAQEVAFKCNGLPGFIEEVATSLKKKSLEKWEES
LVSLSHSTARYQIFISFRGGDTRHVFTKHLHYALCQEGFATFKDDESLEGGVPIEKLLDD
IEESRFAIVILSENYADSEWCLKELVKILECKDKEGKNQLVLPIFYEVPPTDVRHARNSY
ADAMAKHEKNGKDSYTLKTWKKALYDVCTLTGYEKPHDWTRDQFIGKIVKFACDHRHRLH
IQSMYMN
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaggagagggtgccaccatcggaatcgacctcggcaccacctactcctgc
gtcggagtgtggcagaacgacggtgttgaaatcatcaccaacgaccagggcaaccggacc
accccctcttacgtggctttcactgattctgaacgcttgatcggtgatgacgccaagaac
caggtcaccatcaaccccaccaacaccgtcttcgatgcaaagcgtttgattggaaggaaa
ttctctgatgcttctgttcagagtgacatgaagctatggccattcaaggtcattcatggt
cctggcgacaagcctatgattgttgttaactacaagaacgaggagaaacaattcactgct
gaggagatttcctccatggtcctcttgaagatgcgtaagattgctgaggcttacctcggt
tccaccgtgaagaacgccgttgtcactgtcccagcatacttcaatgactctcagcgccag
gccaccaaggacgccggtgtcatcgccggccttaacgtcattcgtatcatcaatgaaccc
actgctgctgcccttgcctatggccttgacatggggcccaccggtgatgatgagaagaat
gtgttgatttttgaccttggtggtggtacttttgatgtcactcttctaatcattgactcc
agtgtctttgatgttaaggccacttccggagacacccatcttggaggtgaagattttgat
aacaggatggtgaactattttgttgaggagttcaagagaaagcacaataaggacattagt
gaggacccgagggctttaagaaggttgaggaatgcatgtgaaaaggcaaagaggactctc
tcatccaccgagcagaccacaattgcaattgactcattgtatgaaggtgttgacttgtac
accgcaatcactcgtgacaggtttgaagaactcaacatggacctcttcaagaagtgcatg
gagactgttgagaagtgtttgagagacgctgagatggagaagagtgacatacatgatgtt
gttcttgttggtgggtctacaaggatccccaaggtgcagtcaatgttgcagggtttcttc
aacgggaaggagctctgcaagagcatcaaccctgatgtggctgttgcttatggtgcttct
gttcaggctgctaaattgagtggtgagaagaataatgagattaaggatcttgtgttgttg
gatgtcactcccctttcacttggtgtggaaactgttggtggtgtcatgactgtactcatt
ccaaggaactttacgattccggccaggaaagagcagattttctcaacctactcagacaac
cagcctggtgtcttgatcaaggtgtacgagggtgagaaaaccagaagcacggaaaacaac
ttgttgggtaaattcgagctttctggcattcctcctgctccaagtggtgttcctaaaatc
aatgtttgctttgaaattgatagcaatggtatattgaatgtctctgctgaggacaagact
acagggaagaagaacaagatcactatcaccaatgacaagggaaggttatccaaggaggag
attgagaagatggtgcaggaagcggagaagtacaattctacaaaagatgctccatatcta
cgcttggaggcacaagtagaacatgatacttgccatcagattacagtaccaaccccaagt
ttacagtcatttccctccggaaactttcgatattatttcaactctacaaaagaggcttct
cagaaacttaaagtggcactaaaagatgataatttctatgtaattggattgcatggaaag
aggggctctggtaaaacaacgttactgaaagataagatagaagagtatgaaacgattttt
cataaagttatatttctccctgtgtctgagaatcaagacacgaagagcattcaagaggaa
tttgcaaagacattgaacgtgtttgaaaaacatgacactgatgctgtaagaatcatgaaa
ataattttggcattagaaaggaaggatagaactactctggtcatcttggataattttccg
tctaagtctaaactgcaagaattaggtattccttataatagcaaacagtacaagttcctt
ttgactgcacgtgacgagacagactgcatcttcatgggatgcgaccattcaatttctctg
gatcccttatctaatgatgaagctttcacactgctacgaaaactttctggtgttaactcc
caatctgctctatttgaagtggcacaagaagttgctttcaaatgcaatggtttacctggg
tttattgaagaggtggcgacttccttgaaaaagaagtccttagagaagtgggaagaatca
ttagttagtctaagccactcaaccgcccgctaccagatttttatcagttttagaggaggt
gatactcgacatgtttttacaaagcacctccattatgctttgtgccaggaggggttcgcg
accttcaaagatgatgagtcattggagggtggggtcccaatcgagaaacttctggatgac
attgaagaatcaaggtttgcaattgtcattttatctgaaaactatgcagactctgaatgg
tgtcttaaggaactcgtcaagattcttgagtgtaaggataaagaggggaagaaccagcta
gttttgccaatcttctatgaagtgccgcccacagatgtaagacatgcacgaaacagttat
gctgatgccatggccaaacatgaaaagaatggaaaagattcatatacacttaaaacatgg
aaaaaggctttgtatgatgtttgtacgctgacgggatatgaaaagcctcacgattggacc
agagatcaatttattggaaagatcgtcaaatttgcctgcgatcacagacatcgcttgcat
atacaaagcatgtatatgaactag

DBGET integrated database retrieval system