KEGG   Lotus japonicus: Lj1g3v3441450.1Help
Entry
Lj1g3v3441450.1   CDS       T04348                                 

Gene name
Lj1g3v3441450.1
Definition
(Kazusa) -
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lja  Lotus japonicus
Pathway
lja00480  Glutathione metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lj1g3v3441450.1 (Lj1g3v3441450.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lja02000]
    Lj1g3v3441450.1 (Lj1g3v3441450.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Lj1g3v3441450.1 (Lj1g3v3441450.1)
Transporters [BR:lja02000]
 Other transporters
  Pores ion channels [TC:1]
   Lj1g3v3441450.1 (Lj1g3v3441450.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_N_4 GST_C_6
Motif
AA seq 222 aa AA seqDB search
MAGSEEEVKLFGSVGSPFVIRVQIALKLKGVEYNYQEETLGSLSDTLLKFNPVYKMVPVF
LHKGKPISESLVILEYIDETWKHNPILPSDPYQRAMARFWSKFIDDKCVAPAWKSAFMID
EKEREKAAEELFEALQFLENELKDKKFFGGEEFGFVDIAALFIPLFKEVAEFKLFTSDQF
PKLYKWSQEFYNHPVVKENMPSKDQLFGYFKARSATLAASRK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccggaagtgaggaagaggtgaagcttttcggatctgtgggaagcccatttgtgatc
agggttcagattgctctcaaattgaagggagttgaatataattaccaggaagaaaccttg
ggcagcttgagtgatacgctcctcaaattcaacccagtttacaagatggttcctgtgttt
cttcacaaagggaaacctatttcagagtcccttgtgatcctggagtacatcgatgagaca
tggaaacacaaccccatcttgccttctgacccttaccagagagccatggccagattctgg
tccaagttcatagatgataagtgcgttgctcctgcttggaaatctgcttttatgattgat
gagaaggagcgtgaaaaggctgctgaggaattatttgaggctctgcagtttcttgagaat
gagctgaaggacaagaagttctttggaggagaggagtttggctttgtggatatcgctgct
cttttcatacctttatttaaagaagtggctgagttcaagttgttcacaagtgaccaattt
ccaaagctatacaaatggagccaagaattttataaccatccagttgtgaaggaaaatatg
ccttctaaagaccaactttttggttatttcaaagctcgctccgcaacccttgctgcctca
agaaaatag

DBGET integrated database retrieval system