KEGG   Lotus japonicus: Lj2g3v1090790.1
Entry
Lj2g3v1090790.1   CDS       T04348                                 

Gene name
Lj2g3v1090790.1
Definition
(Kazusa) -
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
lja  Lotus japonicus
Pathway
lja00943  Isoflavonoid biosynthesis
lja00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    Lj2g3v1090790.1 (Lj2g3v1090790.1)
   00943 Isoflavonoid biosynthesis
    Lj2g3v1090790.1 (Lj2g3v1090790.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     Lj2g3v1090790.1 (Lj2g3v1090790.1)
SSDB
Motif
Pfam: Transferase
AA seq 499 aa
MTHSTCQPYHLTLSNNSLLFNVLFWSEVGTGFWTISQFLIFLYSYQMAQTLKVHQVCTVA
PPQEAAATSLPFTFFDTLWLRLPPVERLFFYDHPNSTTSFFDSVLPTLKHSLSITLQHFL
PLAGTITWPLDSPPPIIPYLPGDAVPLTVAESAADFNQLSSNLCEAQKRHPLIPPLKTSH
EKASVMSLQLTLFPDAGFSIGITTHHAALDGKTSTSFMKAWASVCSNLKVKDQNPCYSLP
ENLTPFFDRSVITDPSGINEVYANSWLNFGGETNNRSLKVWETLGGAIGEDTVKGLFEVT
PSHIKKLKQYAESKIDKNKVRLSSFSVTCAYLISCVVKVEQVKSKRVAFVFSVDCRTRLE
PPIKPTYFGNCIMPHLAVAETGEVLGDDGFINALVVISDELSELESGVMNGAEDWISKIQ
SVAGDKMFSTAGSPRFEVFGVDFGWGRPKKVDVTSVDRTGAFSLSDSRDIHGGIEIGLAL
NKSQMEAFAEVFAKGLESL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgactcattctacttgtcaaccctatcatttgactctgtctaataattctcttcttttt
aatgttttgttttggtctgaagttggaactggattctggacaatctcccagttcctcata
tttctttactcctaccagatggcgcaaacactgaaagttcaccaagtttgcacggtggcg
ccgccacaagaagccgctgcaacctctctccccttcaccttcttcgacaccctatggctg
agactccctccggtggagcgtcttttcttctacgaccaccccaactccaccacctccttc
tttgactctgttcttccaactctcaaacactccctttcaatcaccctccaacacttcctc
cctctcgccggcaccatcacgtggccccttgattcccccccccccatcatcccctatctc
cccggcgacgccgtccccctcaccgtagctgaatcagccgccgatttcaaccagttaagc
tccaacctctgtgaagctcaaaaacgccaccccctcatacctcccctgaaaacctctcat
gagaaagcctctgttatgtcactccagctcactctcttcccagacgctggattctccatt
ggaataaccacacaccatgcagcccttgatgggaaaacctcaacttcattcatgaaagct
tgggcctctgtttgctctaacctcaaagtcaaagatcaaaacccctgttattcactccct
gagaatctaacacctttctttgacaggtcagtgataacagacccttcaggaatcaacgag
gtttatgcgaatagttggttgaatttcggtggagaaaccaacaaccgaagcttaaaggtg
tgggaaacgcttggtggtgcaataggggaggatacagtgaaaggcttgtttgaggtcacc
ccttcacatataaaaaagctgaagcaatatgcagagtccaagattgataagaacaaggtt
cgtttgtcatcgttttcagttacttgtgcttatctgatttcatgtgtggtgaaagtagaa
caagtgaaatcgaagagagtagcttttgtgttcagtgtggattgtagaacccgtttggag
cctccaattaagccaacttattttgggaattgcattatgcctcacttggctgtggctgaa
acaggagaggttttgggtgatgatgggttcatcaatgctcttgtggtgatttctgatgag
ttgagtgaattggagagtggggtgatgaatggagcagaggattggatttcaaagatacaa
tctgtggcgggtgataagatgttttccactgcagggtcacctcggtttgaggtttttggt
gttgattttggatggggaaggcctaagaaggtggatgttacttctgttgatagaactgga
gcattttctctttcagatagtagggacattcatggaggaattgagattggtttggcattg
aacaagtctcaaatggaggcttttgctgaagtttttgccaaaggacttgaatccttgtaa

DBGET integrated database retrieval system