KEGG   Lotus japonicus: Lj2g3v1550250.2Help
Entry
Lj2g3v1550250.2   CDS       T04348                                 

Gene name
Lj2g3v1550250.2
Definition
(Kazusa) -
Organism
lja  Lotus japonicus
SSDB OrthologParalogGFIT
Motif
Pfam: PAN_2 Pkinase_Tyr S_locus_glycop Pkinase B_lectin
Motif
AA seq 440 aa AA seqDB search
MPGMKLGWNLETGLERFLSSWKSTDDPAKGEYTMRIDHRGYPQVFAFKGSDIISRTDQWN
GESLRGYPAPDPKYNQTFVFNEKEVYYEFEFLESSAASLYRLFPSGDGEVISWTIGSGNS
RQVVTKAGLDECDKYAYCGANSICSANGYVATCECLKGYAPKSPQQWSLQNWTDGCVPRN
KTICKNSYTDGFWTYTYSKLPDTSSSWFNKTMNLEECKVLCLRNCSCVAYANLYVTNGGT
GCLLWFHNMVDVRKYSQRGQDLYVRVPPSELDQVAADDNGNTKKKIAGITVGVIIFGFMT
CLSILIIKNPGAARNIYNKHCKNKPRKEDVDLPIFNLSALAHATDNFSSSNKLGEGGFGP
VYKGILIDGQEIAVKRLSKKSGQGLEEFKTEVALIAKLQHRNLVKLLGCCIKGEEKMLIY
EYMPNKSLDYFVFDETKKMS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccgggaatgaagcttggatggaacttagaaactggtctagagagatttctgtcatct
tggaaaagcacggatgaccctgccaagggagaatacacaatgagaattgaccatagagga
tatccacaagtgtttgcattcaaggggtctgatataatttctagaacagaccagtggaac
ggcgagtctcttcgtggatatcctgctccagatccaaaatacaatcaaacatttgtgttc
aacgaaaaagaggtgtattatgagttcgagtttcttgaaagttcggctgccagcttgtat
agactcttcccttcaggtgatggggaggttatatcttggacaattggatcaggtaacagc
cggcaagtcgtcacaaaagcgggcttagatgaatgcgacaaatacgcctattgcggtgca
aattctatatgcagtgctaacggttacgttgcaacttgtgaatgcttgaaaggatatgct
cccaagtctcctcaacagtggagtttacagaattggactgacggctgtgttcccaggaat
aaaactatttgcaaaaacagttacacggatggtttctggacttatacgtattcgaaattg
ccagacacgtcttcgtcttggttcaataagaccatgaaccttgaggaatgtaaggtgttg
tgtctcagaaactgttcctgtgtagcatatgcaaacttatatgttactaacgggggaact
gggtgtctactttggtttcataatatggttgacgtcaggaaatactctcaacggggacaa
gatctttatgttagagtcccaccttcagaactagatcaagttgcagcggatgacaatgga
aacaccaagaagaagatagcgggaatcacagttggtgtgattatttttggattcatgaca
tgtttatccatattgataattaaaaatccaggggctgcaagaaatatttacaacaagcat
tgcaaaaataaaccgagaaaggaagatgttgatttgccaatattcaatttgtcagcctta
gctcatgccactgacaacttttcaagtagtaataaacttggagaaggtggctttggacca
gtatataagggcatattgatagatggacaagagatagcagtgaagagactttcaaaaaag
tctggacaagggttggaagagtttaaaactgaagtagcgttgattgctaaacttcaacac
cgtaatctcgtaaagcttctcggttgttgcattaaaggagaagaaaagatgttgatctat
gaatacatgcccaataaaagcttggactactttgtttttgatgaaaccaaaaagatgtca

DBGET integrated database retrieval system