KEGG   Lotus japonicus: Lj2g3v1968380.2Help
Entry
Lj2g3v1968380.2   CDS       T04348                                 

Gene name
Lj2g3v1968380.2
Definition
(Kazusa) -
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
lja  Lotus japonicus
Pathway
lja04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lja03041]
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
   03110 Chaperones and folding catalysts [BR:lja03110]
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
   04121 Ubiquitin system [BR:lja04121]
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
Enzymes [BR:lja01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Lj2g3v1968380.2 (Lj2g3v1968380.2)
Spliceosome [BR:lja03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
Chaperones and folding catalysts [BR:lja03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Lj2g3v1968380.2 (Lj2g3v1968380.2)
Ubiquitin system [BR:lja04121]
 Ubiquitin ligases (E3)
  U-box type E3
   Lj2g3v1968380.2 (Lj2g3v1968380.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rtf2 U-box zf-NOSIP
Motif
AA seq 210 aa AA seqDB search
MGKKQHSKDRMFITKTEWATEWGGFKSKDNRTVFKRLPFYCCALTFTPFEYPVCTPDGSV
FDVMNITPYVIKYGKHPVTGTPLKQQDLIPLNFHKNSEGEFQCPVLNKVFTEFTHIVAVK
TTGNVFCYEAVKELNIKTKNWKELLTDEPFTRDDLITIQNPNALDSKVLLDFDHVKHNLK
IDDEELQKMSSDPTYNINMSGDLKQMFQEI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagcagcacagcaaagacagaatgttcatcacgaaaaccgagtgggcaacg
gaatggggaggcttcaaatccaaagacaaccgcaccgtcttcaagcgtcttccattctat
tgctgcgcccttacattcacgccgtttgagtatcccgtttgtacacctgatggcagtgtt
ttcgatgttatgaacatcactccttatgttatcaaatatggtaaacatcctgttaccgga
actccgttgaagcagcaggatctcattccactcaatttccacaagaattcagaaggagaa
tttcagtgtcctgtgctaaataaagttttcactgaatttacacatattgtggcggtgaag
acaacaggaaatgtgttctgctatgaggccgttaaagagttaaacattaagacaaaaaac
tggaaggagcttctcactgatgaaccattcactagggatgaccttataacaattcagaat
cctaatgcacttgacagcaaggttcttctggattttgatcatgttaaacacaatctgaaa
attgacgatgaagaactacagaaaatgagttcggatccaacatataatataaacatgtct
ggtgatctcaagcaaatgtttcaggagatt

DBGET integrated database retrieval system