KEGG   Lotus japonicus: Lj3g3v0323220.1Help
Entry
Lj3g3v0323220.1   CDS       T04348                                 

Gene name
Lj3g3v0323220.1
Definition
(Kazusa) -
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lja  Lotus japonicus
Pathway
lja00052  Galactose metabolism
lja00500  Starch and sucrose metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Lj3g3v0323220.1 (Lj3g3v0323220.1)
   00500 Starch and sucrose metabolism
    Lj3g3v0323220.1 (Lj3g3v0323220.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Lj3g3v0323220.1 (Lj3g3v0323220.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
AA seq 501 aa AA seqDB search
MFYQYNPKGAVWGNIVWAHSVSEDLVNWRPLDHAISPSQPADINGCWSGSATILPGGKPA
MLYTGIDPNKHQVQNLAIPKNMSDPLLREWVKSPKNPLMAPTIANKINSSSFRDPTTAWL
GKDGYWRVLIGSKTNTRGEAIMYKSKNFVNWVQAKYPLHSAEGTGMWECPDFYPVLNKIP
FAFGLDTSVNGNDVRHVLKVSLDDTKHDHYLIGSYDTAKDNFIPDKGFEDNKSVLRYDYG
KYYASKTFFDDGKNRRILLGWVNESSSVADDIKKGWSGIHTIPRAIWLHKSGKQLVQWPV
VEIEKLRMNPVYWPAKKVKGGELLQVAGVNAVQSDVEISFEVNEIGKAEVLDHWIDPQIL
CSRKGAAVKGAVGPFGLLVFASQGLKEYTAVFFRIFKYQHQNLVLMCSDQSRSSLNKDND
MTTYGTFLDVDPLHEKLSLRTLIDHSVVESFGGEGKACITARVYPTLAINDKAKLYAFNY
GTTAVKITRLSAWSMKKAKVN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttttatcaatacaatcctaaaggagcagtttggggaaatattgtctgggcccactct
gtatcagaggatcttgtgaattggaggccattagatcatgccatctccccttctcagcca
gcagatatcaatggatgttggtcaggttcagcaacaattcttcctggaggcaaaccagcc
atgttatacacaggaattgaccccaacaaacaccaagttcaaaacttagccatccccaaa
aacatgtctgacccattacttagggaatgggttaagtcaccaaaaaatcccttaatggca
cctaccattgctaacaagataaattcaagctcatttagagaccctaccactgcttggcta
ggaaaagatgggtactggagggtgctgattggaagcaaaactaacacaaggggtgaggca
attatgtacaagagcaaaaactttgttaattgggttcaagccaaataccctcttcattca
gctgaaggcactggaatgtgggagtgccctgatttctatccagtgctgaataagatccca
tttgcctttggtcttgatacttctgtgaatggtaatgatgttagacatgtgctcaaggtt
agtttggatgatacaaaacatgatcactatttgattgggagttatgacactgccaaggat
aacttcattcctgataaggggtttgaggataacaaatctgtcttgagatatgattatggg
aaatactatgcctcaaaaactttttttgatgatggaaagaacagaaggatcttgttgggt
tgggttaatgaatcctcaagtgttgcagatgatatcaagaaaggatggtctggaatccac
actattccaagggctatctggcttcataaatcaggaaaacagttggtgcaatggccggtt
gtggaaattgagaaactacgtatgaacccagtctattggccagccaaaaaggtcaaggga
ggtgaactgcttcaagttgctggtgttaatgcagtacagtctgatgttgaaatttcattt
gaagtaaatgagattgggaaggccgaagtattggaccattggattgatccccaaattctg
tgtagtagaaagggtgcagccgtaaaaggagctgtgggaccatttggtctgctggtgttt
gcttcacaaggcttgaaagaatacacagcagtgtttttcagaatattcaaataccaacat
caaaatttggttctcatgtgtagtgaccaaagcaggtcttctttgaataaagataacgat
atgaccacttatggaacttttctagatgttgacccgcttcatgagaagttgtcactaaga
actttgattgatcactcagtagtagagagttttggtggagaaggaaaggcatgcatcaca
gccagagtttaccccacattagcaatcaatgataaggcaaagctatatgcattcaattat
ggaactaccgctgtgaagatcacaagattgagtgcttggagcatgaagaaagcaaaagtc
aactgaaac

DBGET integrated database retrieval system