KEGG   Lotus japonicus: Lj3g3v1855390.1Help
Entry
Lj3g3v1855390.1   CDS       T04348                                 

Gene name
Lj3g3v1855390.1
Definition
(Kazusa) -
Organism
lja  Lotus japonicus
SSDB OrthologParalogGFIT
Motif
Pfam: Stress-antifung Pkinase_Tyr Pkinase
Motif
AA seq 477 aa AA seqDB search
MFNFVSMYYYNSYIMCMALPMGNWRLKSSFSSFMFLLFFLLLHFTPTITAQSPIYMYTFC
HNSTTGKSPTTSYQSNVNNFLSWVTSDSITGTVYNETIIGNNGDGDGDAAVYGNYNCRGD
LSGYFCQFCLTTAAREIAQRCPNTVTAMIWYDTCIIRCSNYNFFGKISLTPAWNVSGSKT
IKDSTELRKAQDDMRGSITKLTNQNQNQYWGTVEFNWTNTEKRYGLLQCSKDLTSHDCRQ
CLETLLDIVPLCCETKVSWAIMAPSCGMKFDDYRFYQITNQTGTGSPSLIPNPAEHEGGR
NTKNRIIIIVSVLVAVALLICCVYYSWSKNGLCKVGLLLKTNPTASNDHVQREESLNEDL
PIIPLAVIQKITNNFSESSKLGEGGFGPVYKGTLPDGTEIAVKRLAETSGQGLEEFKNEV
IFIAKLQHRNLVKLLGCCIEENEKMLVYEYMQNSSLDFHLFRIQCSFACQMRKSKSN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattttgtgtctatgtattattataactcatatattatgtgcatggctctacct
atgggaaattggagattaaaaagctcattttctagcttcatgttcctcctttttttcctc
ctgctccatttcaccccaacaataactgcacaatctccaatttacatgtacactttttgc
cacaactcaacaacaggcaaatctcctaccacttcataccaatccaatgtcaacaacttc
ctctcatgggtaacctctgattccatcacaggcacagtatataacgaaaccataataggc
aacaatggtgatggtgatggtgatgctgctgtttatgggaactacaattgcagaggagac
ctaagtggatatttctgccaattctgtctcaccaccgccgcgagagaaatcgcgcaacgc
tgtcccaacactgtcacagctatgatatggtatgacacatgcatcattcgttgctccaac
tacaatttctttggaaaaatttctttaacgccggcatggaacgtttccgggtccaaaacc
ataaaggactcaacagagcttaggaaagcacaggatgacatgaggggttcgataacaaaa
ctaactaaccagaaccagaaccagtactggggaactgttgagtttaattggactaacact
gagaaaaggtatggcttgttgcagtgtagtaaagaccttactagtcatgattgcagacag
tgtttagagactctgttggatatagttcccctgtgttgtgagacaaaggtatcatgggca
attatggcaccaagctgtgggatgaagtttgatgattataggttctaccagattaccaat
cagacaggaacaggatccccttctcttattccaaatccagccgagcatgaaggtggaaga
aataccaaaaaccggattattatcatagtaagtgtgttggtagcagtagctctactaatt
tgttgtgtctattattcctggagcaagaatggtttatgtaaagttggattgctgttgaag
accaatcctacagcttctaatgatcatgttcaaagagaggaatcattgaatgaagacctt
cctataattcctttagctgtaattcaaaagataactaataacttttcagagtcatccaaa
ttaggagaaggtggatttggacctgtttacaagggtactctaccagatgggactgaaatt
gctgtcaaaaggcttgcggaaacgtctggtcaaggtttagaggagttcaagaatgaagta
atcttcatagctaaactgcaacacagaaatcttgtcaaactcttgggttgctgcattgag
gaaaatgagaagatgctagtatatgagtacatgcaaaattcaagccttgattttcaccta
ttcagaatccaatgttcatttgcttgtcagatgaggaaaagcaaaagcaattagatt

DBGET integrated database retrieval system