KEGG   Lotus japonicus: Lj3g3v3188370.2Help
Entry
Lj3g3v3188370.2   CDS       T04348                                 

Gene name
Lj3g3v3188370.2
Definition
(Kazusa) -
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lja  Lotus japonicus
Pathway
lja00520  Amino sugar and nucleotide sugar metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lj3g3v3188370.2 (Lj3g3v3188370.2)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Lj3g3v3188370.2 (Lj3g3v3188370.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind KR adh_short Sacchrp_dh_NADP
Motif
AA seq 185 aa AA seqDB search
MAANPSNGDQQTTPSKQPPLPSPLRFSKFFQSNMRILITGGAGFIGSHLVDRLMEKEKNE
VIVADNYFTGSRDNLKKWIGHPRFELIRHDVTETLMIEVDQIYHLACPASPIFYKYNPVK
TIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEG
KTWNR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaatccttctaatggagatcaacaaacaacaccttctaagcaacctcccttg
ccatctcccttgcgtttctccaaattctttcagtcgaacatgagaatcttgattactggt
ggggctggattcattggttcgcacctagtcgatagattgatggaaaaagaaaaaaatgag
gtcattgttgctgataactacttcactgggtcaagagacaacctcaaaaaatggattggc
catccaagatttgaacttatccgccatgatgtcactgagactttgatgattgaggttgat
cagatctaccatcttgcatgccctgcgtctcctattttttacaaatataatcctgtgaag
acaattaagacaaatgtgattggcacactgaacatgcttgggcttgcaaagcgagttgga
gcaaggattttgcttacatcaacttcagaggtttatggggatcctcttatacatccccag
cctgaaagctattggggcaatgttaaccccatcggagttcgtagttgttatgatgaggga
aaaacatggaataggtaa

DBGET integrated database retrieval system