KEGG   Lotus japonicus: Lj3g3v3654520.1Help
Entry
Lj3g3v3654520.1   CDS       T04348                                 

Gene name
Lj3g3v3654520.1
Definition
(Kazusa) -
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
lja  Lotus japonicus
Pathway
lja00130  Ubiquinone and other terpenoid-quinone biosynthesis
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Lj3g3v3654520.1 (Lj3g3v3654520.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     Lj3g3v3654520.1 (Lj3g3v3654520.1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     Lj3g3v3654520.1 (Lj3g3v3654520.1)
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     Lj3g3v3654520.1 (Lj3g3v3654520.1)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     Lj3g3v3654520.1 (Lj3g3v3654520.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_3 BAAT_C Ndr Abhydrolase_2 DLH Chlorophyllase Esterase FSH1 Lipase Thioesterase DUF676 DUF726 Lipase_3 DUF2974
Motif
AA seq 612 aa AA seqDB search
MLLKPSSVFPSVRCGFEMAILNAIADAKGSTLLNILHPPTNENGDCERSLEVQVCALINS
NGSPTEVANVAATLVEEGFSAIKLKVARGGDPVQDAALIQEVRKKVGRQIIIRADANRKW
TYEEAMKFSSLVKDCNLQYIEEPVQDEDDILMFCEQSGLPVALDETIDKIQENPLEKLVK
FTHPGIVSVVIKPSVVGGFENAALIAQWAHQLGKMAVVSAAFESSLSLAAYTQFSSYLEI
LRLSTFKVLNYKEEPSVAHGLGTYSWLKEDVTPNPLFVGPNPLSGFVEASVANASRVLHN
FEVNQNVICNMITGEQICQYQLKVEHNNLSCSFEVREVGLKSNENVLVFLHGFLGTGEDW
ITIMKTFSGSARCISVDLPGHGKSIIHGVRGAGEVPWLSVELIADILHKLIHHLAPAEVT
IVGYSMGARIALYMALTFRSKIKAAALISASPGLKDPLSRKIRAAKDDSRARFVVEHGLQ
LFLSSWYAGELWKSLRSHPHFNRIIASRLQHNDIQSLAQMLSGLSIGRQTALWEDLPNCR
VPLLIIHGEKDTKFKKIAQEMMHTICSGLGRNEHAEGNNIHQVVEVPNCGHAPHLENPLP
VITALRKFMSRL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctattaaagccaagttctgtttttcccagtgtcagatgtgggttcgaaatggctatc
ctcaatgccatagctgatgcaaaaggctcaaccttgttgaacatactgcatcccccaaca
aatgagaacggtgattgtgaaaggtcattagaagttcaggtttgtgcactaataaattca
aatggatctccaactgaagtagctaatgttgctgccacactagtggaagaaggattttct
gcaattaagctaaaggtagcacgtgggggtgatccagtgcaagatgccgcattaatacaa
gaagtaagaaagaaagttggtcgccagattatcatccgtgcagatgcaaatcggaaatgg
acttatgaagaagctatgaaattcagctctttggttaaggattgtaacctgcagtatatt
gaggaacctgttcaggatgaagatgatattctcatgttctgtgaacaaagtggattacct
gttgccctagatgaaacaatagataaaattcaagaaaatcccctggaaaagctagtgaag
tttactcatccaggaatagtttctgttgttatcaagccaagcgttgttggtggatttgag
aatgcagcattaattgcacaatgggcacaccagctggggaagatggctgttgtcagcgct
gcatttgaaagcagtctgagtctggctgcatatactcagttttctagttatcttgaaata
ctgagattgagtacattcaaagtgttaaattataaggaagaaccttctgtagctcatggt
ctaggaacctatagttggcttaaggaagatgtaacacctaatcctcttttcgttggtcct
aatccgcttagtggttttgttgaagcatctgtggcaaatgcgagtcgcgtactacataat
tttgaagtcaaccagaatgttatctgcaatatgattactggggagcaaatttgtcagtac
caattgaaagtagagcataacaatttatcttgttcttttgaagttcgtgaggttggccta
aaatcaaatgaaaatgtattagtatttcttcatggttttcttggaactggtgaagactgg
attactatcatgaagaccttttccggatcagcaagatgcatttcagttgaccttcctggt
catggaaaatcgataatacatggtgtaagaggtgctggtgaggtaccatggttgtcagtg
gagctaattgctgatatattacataaactgattcaccatctagctcctgctgaagttaca
atagttgggtattcaatgggagcaaggattgctttgtatatggctctgacatttaggagt
aagattaaggcagctgcgttaatatctgcaagccctggattaaaagatccattatcaaga
aaaattcgagcagctaaagatgattccagagcacgctttgtcgttgaacacggtttacaa
ctttttctcagttcctggtatgcaggagagctgtggaaaagcttaagaagtcatccccat
ttcaatcgaatcattgctagtcgcttgcagcataatgacatacagagtcttgcacagatg
ctatctggattaagcattgggaggcaaacggcattgtgggaagatttgccaaattgcaga
gtacctcttcttatcatacatggagagaaggatacgaaatttaagaaaattgctcaagaa
atgatgcatacaatatgctctggcttggggaggaatgagcacgcagaagggaataacata
catcaggtggttgaggttcccaactgtgggcatgctccacatttggagaatcctcttcct
gtcattactgccttgagaaaattcatgtcaagactatgaaag

DBGET integrated database retrieval system