KEGG   Lotus japonicus: Lj4g3v0083870.1Help
Entry
Lj4g3v0083870.1   CDS       T04348                                 

Gene name
Lj4g3v0083870.1
Definition
(Kazusa) -
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lja  Lotus japonicus
Pathway
lja00350  Tyrosine metabolism
lja01100  Metabolic pathways
Module
lja_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Lj4g3v0083870.1 (Lj4g3v0083870.1)
Enzymes [BR:lja01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Lj4g3v0083870.1 (Lj4g3v0083870.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
AA seq 226 aa AA seqDB search
MATSQSVVGEEQQDNKLKLYSYWRSSCSFRVRIALNLKGLKYEYKPVNLLKGEQSNPEFL
KLNPVGCVPVLVDGPAVIFDSFAIIMYLEDKYPNHPLLPRDINQRAINFQATSIVFSAIQ
PLHNLGILNYVGEKGGPDAKIPWVQSVIRKGFTALEKLLKEHAGRYATGDEVFLADIFLA
PQLHAAYNRFNIQMDEFPILARLHETYYEIPAFREALPENQPDAAR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagtcaaagtgttgttggcgaagaacaacaagataacaagctcaagctttat
tcatattggaggagctcttgttccttccgagtccgaattgctctcaacctcaaagggctc
aaatatgagtacaaaccagtcaatctgttgaagggagaacaatctaaccctgagtttctc
aagctcaaccctgttggctgtgttcctgttctggtcgatggccctgctgtcatctttgat
tcgttcgccattattatgtatttggaggacaagtatccgaaccatcctttgcttcctcgt
gatattaatcaaagagcaatcaatttccaggctaccagtattgttttctcagcaatacaa
cctcttcataacttgggtattctgaattacgttggggaaaaaggtggccctgatgcaaaa
attccttgggtccagagtgtaattagaaaaggcttcacagcacttgaaaagctattgaaa
gaacatgctggaagatatgcaactggagatgaagttttcctggcagatatatttttagcg
cctcagttgcatgctgcatataacaggttcaacattcaaatggatgagttccctattcta
gcaaggttacatgagacatattatgagatcccagcatttcgggaggctttgccagagaac
cagccagatgcagcacgctag

DBGET integrated database retrieval system