KEGG   Lotus japonicus: Lj4g3v0445550.1Help
Entry
Lj4g3v0445550.1   CDS       T04348                                 

Gene name
Lj4g3v0445550.1
Definition
(Kazusa) -
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Lj4g3v0445550.1 (Lj4g3v0445550.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     Lj4g3v0445550.1 (Lj4g3v0445550.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 NAD_binding_8 BET EF-hand_8 NAD_binding_7 LysR_substrate p25-alpha AAA_assoc Caleosin Epimerase
Motif
AA seq 574 aa AA seqDB search
MRNFTFFEQAFRDHRSQLKLVLFCTTVSGGGLLAYGEAVAASEPEQKKKKVVVLGTGWAG
TTFLRNLNNPRYEVHVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKKVNAYFN
EAECVKIDAANKKIYCRSNINNNLNVKDEFVVDYDYLVIAVGANVNTFNTPGVVENCHFL
KEVEDAQRIRRTVIDCFERASLPSISEEERKRILHFAIVGGGPTGVEFAASLHDFVNEDL
VKLYPKAKDLVKITLLEAGDHILSMFDKRITAFAEDKFRRDGIDVKTGSMVVKVSDKEIS
TKEMKNGGEITSIPYGMAVWSTGIGTRPFIRDFMQQIGQINRRAVATDEWLRVEGTDNVY
ALGDCATINQRKVMEDIAAIFKKADADNSGTLTVKELQEVLHDICERYPQVELYLKSKQM
NNVADLLKESKGDVKKESIELHIEELKTALSNVDSQMKFLPATAQVASQQGTYLAKCFDR
MEECEINPEGPLRFRGEGRHRFKPFRYKHLGQFAPLGGEQAAAQLPGDWVSIGHSTQWLW
YSIYASKQVSWRTRALVVTDWTRRFLFGRDSSQI
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatttcactttcttcgaacaagctttccgtgaccatcgctcacagttgaagctc
gttctcttctgcaccaccgtcagtggtggtggacttttggcatacggtgaggctgttgct
gcatctgaaccggagcagaagaagaagaaggtcgtggtgctgggaactggctgggcaggg
acgactttcttgaggaatttgaacaatccaagatatgaggttcatgtggtgtcgcctcgc
aactattttgccttcactcctttgctgccaagcgttacctgtggaactgtggaagcgaga
agcattgttgaacccgtccgcaacatctttaggaagaaaaaggtgaacgcttatttcaat
gaagcagagtgtgtcaagattgacgcagcaaacaagaaaatttactgtcgatctaatata
aacaataacttgaacgttaaagacgaatttgtcgtggactatgactacctagtcatagct
gtgggagcaaatgtcaacacatttaacactcccggggtggtggagaattgccatttcttg
aaggaagttgaagatgcacagaggattagaagaactgttattgactgctttgaaagagca
agtttgccgagtataagtgaagaagaaaggaagagaattcttcatttcgctattgttgga
ggtggtccaactggagtggagtttgcagcctcgctccatgactttgtcaatgaggatttg
gtcaagttatatcctaaggcaaaagatttagtcaaaattacgcttctggaggctggagat
catattttgagcatgtttgacaaaagaatcactgcttttgctgaagacaagttccgaaga
gatggtattgatgtgaaaaccggatccatggttgtgaaggtatctgataaagaaatttct
actaaagaaatgaaaaatggaggggaaattacttcaattccatatggaatggccgtctgg
tcaactggtatcggaactcgtccatttataagagattttatgcaacaaattggtcagatt
aacagacgtgcggtagctactgatgaatggttgagagttgagggaaccgacaacgtatat
gcacttggtgattgtgctacaataaaccagagaaaagtcatggaagatattgcggcaata
tttaagaaggctgacgcagacaattcaggaacccttacagtcaaagaactgcaagaggtg
ttgcatgacatctgtgaaagataccctcaggtggagctatatctgaaaagtaaacagatg
aacaatgttgctgatctgttgaaggaatccaaaggagatgttaaaaaggaatccattgaa
ctgcatatcgaagaactaaaaaccgcactttctaatgtggactcccagatgaaatttctt
cctgctacagcgcaggttgcatctcagcaaggcacctaccttgccaagtgttttgacagg
atggaagagtgtgaaataaatccagagggtcctctcaggttcaggggagaagggcgccat
cggttcaaaccctttaggtacaagcatttaggccaatttgctcctctgggaggagagcag
gcagctgcacagcttcctggggattgggtttcaattggacacagcactcaatggctgtgg
tattctatctatgcaagcaagcaagtcagctggcgtacaagagcattggtagtaacagac
tggacaagacgctttcttttcgggagggactcaagtcaaatatga

DBGET integrated database retrieval system