KEGG   Lotus japonicus: Lj4g3v2704700.2Help
Entry
Lj4g3v2704700.2   CDS       T04348                                 

Gene name
Lj4g3v2704700.2
Definition
(Kazusa) -
  KO
K12448  UDP-arabinose 4-epimerase [EC:5.1.3.5]
Organism
lja  Lotus japonicus
Pathway
lja00520  Amino sugar and nucleotide sugar metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lj4g3v2704700.2 (Lj4g3v2704700.2)
Enzymes [BR:lja01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.5  UDP-arabinose 4-epimerase
     Lj4g3v2704700.2 (Lj4g3v2704700.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 NAD_binding_10 adh_short NAD_binding_8 KR
Motif
AA seq 398 aa AA seqDB search
MLNFVRSRSQARATRPTTMGSMDYVDQKRKGNFVGKVFLAAALTTLCIIMIRRSPSLNSP
SPFSVHEPGVTHVLVTGGAGFIGSHAALRLLKDNYRVTIVDNLSRGNLGAVRVLQNLFPE
PGRLQFIYADLGDAKSVNKIFLENKFDAVMHFAAVAYVGESTVDPLKYYHNITSNTLLVL
ESMAKHDVKTLIYSSTCATYGEPEKMPITEETPQSPINPYGKAKKMAEDIILDFSKNSDM
AVMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGTDYKTSDG
TCIRDYIDVTDLVDAHVKALEKAQPSKVGIYNVGTGKGSSVKEFVEACKKATGVDIKVEF
LPRRPGDYAEVYSDPEKIKRELNWTAKHIVLQESLGIA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctaaattttgtcaggtccagaagtcaagcaagggcaactagacctacaacaatggga
agcatggattatgtggatcaaaaaaggaagggcaactttgttggaaaagtttttcttgct
gcagcattaacgactctatgcataatcatgatcaggagatctccatctctgaattccccc
agtccgttttccgtccatgaacccggggtcactcatgttttagtaacagggggtgcaggc
tttattggctcacacgcagctctacgacttctcaaggataactatcgtgttaccatagta
gacaatctttcacgaggaaatttgggtgcagtcagggttctccaaaacttatttccagaa
cctggaaggcttcaattcatatacgctgacttgggagatgctaaatctgttaataaaata
tttttggagaacaaatttgatgctgtgatgcactttgctgctgttgcatatgtgggagaa
agcactgtggatcctctgaagtattatcacaatattacatcaaataccttgttggtattg
gagtcaatggccaaacatgatgtgaagacattgatctattcaagtacatgtgcaacatat
ggggaacctgagaagatgcctattacagaagaaacaccgcagtcccccatcaatccatat
gggaaagccaagaaaatggctgaagatatcatccttgatttttctaaaaattcagacatg
gcagtaatgattctaagatactttaatgtgattggatcagatcctgagggaagattgggt
gaggctcctagacctgaactgcgagagcaaggtcggatatcaggtgcctgctttgatgcg
gctcgtggcattataccaggcttaaaggttagaggaacagactataagacaagtgatgga
acttgcatacgagattacattgatgtgactgaccttgttgatgctcatgtgaaagctctt
gaaaaggcacaacctagtaaagttgggatctacaatgttggcactggaaagggtagttca
gtgaaggagtttgtggaagcttgcaagaaggctacaggggtggacattaaagtggaattc
cttcctcgccgtcccggtgattacgctgaggtgtatagtgacccggaaaagatcaaacgc
gaactgaattggactgcaaagcacattgttcttcaagagagtttagggattgca

DBGET integrated database retrieval system