KEGG   Lotus japonicus: Lj5g3v0406100.2Help
Entry
Lj5g3v0406100.2   CDS       T04348                                 

Gene name
Lj5g3v0406100.2
Definition
(Kazusa) -
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lja  Lotus japonicus
Pathway
lja00052  Galactose metabolism
lja00500  Starch and sucrose metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Lj5g3v0406100.2 (Lj5g3v0406100.2)
   00500 Starch and sucrose metabolism
    Lj5g3v0406100.2 (Lj5g3v0406100.2)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Lj5g3v0406100.2 (Lj5g3v0406100.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
AA seq 228 aa AA seqDB search
MSEKQPYRTSYHFQPQQNWMNDPNGPMYHKGVYHFFYQYNPYAATFGEKMVWAHSVSYDL
INWIHLNHALEPTEPYDINSCISGSVTILPGEVPAIFYTGIDDKKHQVQNLAFPKNLSDP
FLREWEKHPQNPVLTPPAGVEVDNFRDPSTAWKGEDGKWRVVIGAHHGDEGKVILFQSED
FINWTLYPIPKPFFAIDNTGVECPDFFPVSINSTNGVDTSVQNPGVRN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaacaaccataccgaacttcttatcactttcagccccagcaaaactggatg
aacgatccaaatgggcctatgtaccacaaaggtgtttaccattttttctaccaatataat
ccctatgcagcaaccttcggagaaaagatggtgtgggctcactctgtatcctatgatctc
atcaattggattcacttgaatcatgctcttgaaccaactgaaccctatgacatcaatagt
tgcatatcaggttctgtcactattcttccaggggaagtacctgccattttttacacaggg
attgatgataagaagcatcaagtacagaacttggcatttccaaagaatctctcagaccct
ttcttgagggaatgggagaaacaccctcaaaaccctgtcttgactccacctgctggagtt
gaagtggataatttcagagacccttccactgcttggaagggagaggatggaaaatggaga
gtagtcattggtgctcaccatggtgatgaaggcaaagtgattctcttccaaagtgaagat
tttattaattggacattgtatccaattccaaaacccttttttgcaatagacaatactgga
gttgaatgccctgatttctttcctgtgtccataaatagcacaaatggggttgatacctct
gtccaaaatcctggtgttaggaactagtct

DBGET integrated database retrieval system