KEGG   Lotus japonicus: Lj5g3v0615080.2Help
Entry
Lj5g3v0615080.2   CDS       T04348                                 

Gene name
Lj5g3v0615080.2
Definition
(Kazusa) -
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lja  Lotus japonicus
Pathway
lja00520  Amino sugar and nucleotide sugar metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lj5g3v0615080.2 (Lj5g3v0615080.2)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Lj5g3v0615080.2 (Lj5g3v0615080.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4
Motif
AA seq 225 aa AA seqDB search
MGTLNMLGLAKRIGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGERSCYDEGKRTAET
LAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQAIRKQPLTVYGDGKQTRSFQ
YVSDLVNGLAALMDGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEYKPNTADDPHM
RKPDITKAKELLNWEPKVPLREGLPLMVSDFRNRILNEDEGKGMK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgctgaatatgttgggtcttgcgaagaggattggggcgaggtttctgctgacg
agtactagtgaggtttacggtgatcccttggagcatccacagaaagagacttactggggg
aatgtcaatccaataggtgagaggagttgttacgatgaagggaagcgaactgcggaaaca
ttggctatggattatcatcgaggcgccggagttgaggttcgtattgctcgaattttcaac
acatatggaccccgcatgtgtttagatgatgggcgtgtcgttagcaactttgttgcacag
gctattcgcaaacaaccattgactgtatatggtgatgggaagcaaacaagaagtttccaa
tacgtttctgatttggttaatgggcttgcagctttgatggatggtgaacatgtaggacct
tttaacttgggtaacccaggggagttcaccatgttagaacttgctgaggttgtcaaagaa
acaattgattcaagtgctaccatagaatacaaaccaaatactgctgacgatccacatatg
aggaagccagatattaccaaagcaaaggaactactgaactgggagccaaaagtcccgctg
agagaaggattgcctctcatggttagtgatttccggaatcggattttgaatgaagatgaa
ggaaaagggatgaaataa

DBGET integrated database retrieval system