KEGG   Lotus japonicus: Lj5g3v0709800.1
Entry
Lj5g3v0709800.1   CDS       T04348                                 

Gene name
Lj5g3v0709800.1
Definition
(Kazusa) -
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lja  Lotus japonicus
Pathway
lja00100  Steroid biosynthesis
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Module
lja_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Lj5g3v0709800.1 (Lj5g3v0709800.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Lj5g3v0709800.1 (Lj5g3v0709800.1)
SSDB
Motif
Pfam: ERG4_ERG24
AA seq 195 aa
MFSSESHMDLGCPVHGLIPSWNSAALLAGFFAYLAIAGSVVPGKLIAGVVLPDKSRLRYR
CNGLLSLLLLVALLGIGAKMGFVSPTAISERGLELLSTTFIFSFLVALILYFSGCKSQSK
SSSLKPHISGNLIHDWWFGIQLNPQVMGIDLKFFFVRAGMMGWLLINLSVLAKSIQDDTL
SQSMILFQLFCGVIT
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttcagttcagagtcacacatggatctgggttgtcccgttcacggtctcattccatct
tggaactccgctgctttacttgcagggttctttgcttacttagccattgctggatcagtt
gttcctggaaaactcattgctggggttgttttgcctgataaatctcgccttcgctatcgc
tgcaatggtctgctatcacttcttctgttggtggcgcttcttggaatcggtgccaagatg
ggttttgtatctcctactgccatatcagagagaggacttgagctgctgtccacaactttt
atcttcagttttcttgtggcgctaatcctttatttttctggttgcaagtctcaaagtaaa
tcttcatcactaaaacctcatatcagcggtaacctgatacatgattggtggtttggaata
caactgaatcctcaagtcatgggtattgacctcaaatttttctttgttcgagctggaatg
atggggtggctacttatcaatctatcagttcttgcaaaaagcattcaagatgatactttg
agccagtcaatgattctcttccagctattctgtggtgtaatcacataaact

DBGET integrated database retrieval system