KEGG   Lotus japonicus: Lj5g3v0962490.1Help
Entry
Lj5g3v0962490.1   CDS       T04348                                 

Gene name
Lj5g3v0962490.1
Definition
(Kazusa) -
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lja  Lotus japonicus
Pathway
lja00480  Glutathione metabolism
lja00590  Arachidonic acid metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Lj5g3v0962490.1 (Lj5g3v0962490.1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lj5g3v0962490.1 (Lj5g3v0962490.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Lj5g3v0962490.1 (Lj5g3v0962490.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
AA seq 60 aa AA seqDB search
MGASQSISENSIHEFAVKDARGKDVNLNVYKGKVLLVVNVASKCGFAEANYTQLTQLYTR
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttcacaatcaatctctgaaaattccattcatgaattcgcagtaaaggatgcc
agaggaaaagatgtgaatctcaatgtctacaaggggaaagttcttcttgtagttaatgtt
gcttcaaaatgtgggtttgcggaggccaattacactcagttaactcagctttacaccaga

DBGET integrated database retrieval system