KEGG   Lotus japonicus: Lj6g3v0291960.2Help
Entry
Lj6g3v0291960.2   CDS       T04348                                 

Gene name
Lj6g3v0291960.2
Definition
(Kazusa) -
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
lja  Lotus japonicus
Pathway
lja00061  Fatty acid biosynthesis
lja00071  Fatty acid degradation
lja01100  Metabolic pathways
lja01212  Fatty acid metabolism
lja04146  Peroxisome
Module
lja_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Lj6g3v0291960.2 (Lj6g3v0291960.2)
   00071 Fatty acid degradation
    Lj6g3v0291960.2 (Lj6g3v0291960.2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Lj6g3v0291960.2 (Lj6g3v0291960.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lja01004]
    Lj6g3v0291960.2 (Lj6g3v0291960.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lja04147]
    Lj6g3v0291960.2 (Lj6g3v0291960.2)
Enzymes [BR:lja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Lj6g3v0291960.2 (Lj6g3v0291960.2)
Lipid biosynthesis proteins [BR:lja01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Lj6g3v0291960.2 (Lj6g3v0291960.2)
Exosome [BR:lja04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Lj6g3v0291960.2 (Lj6g3v0291960.2)
  Exosomal proteins of breast cancer cells
   Lj6g3v0291960.2 (Lj6g3v0291960.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
AA seq 647 aa AA seqDB search
MAAIPISSSFNYASTFSYSSVHALPLFFARHNLTRVKLSRPCSFPVFCLSESKTEKTQIR
RFSPFLESSLLSGNDAVASDEWKTVPDIWRSSAQKYGDKIALVDPYHDPPSTMTYKQLED
AILDFSEGLRVIGIRPDEKLALFADNSCRWLVADQGMMACGAINVVRGSRSSTEELLQIY
NHSESVGLAVDNPELFNRIAKQFYLKASMRYIILLWGEKSSLIREVEKEVPVFTFMEVIH
LGRESRKALFGSHDARQHLTYEAIKSDDIATLMYTSGTTGNPKGVMLTHQNLLHQIKNLC
DIVPAEVGDRFLTMLPPWHAYERACEYFIFSCGVEQVYTTVRNLKDDLGRYQPHYLISVP
LVYETLYSGIQKQISRSSLVRKLVALTFIRVSLGYMECKRIYEGKCLTKDPKSPSYLYSV
LDWLWARVIAAILFPVHMLAKKLVYSKIHLAIGILKAGISGGGSLSSHVDKFFEAIGVNV
QNGYGLTETSPVVAARQLSCNVIGSVGHPIKHTEFKVVDSETDEVLPPGSKGILKVRGPQ
LMKGYYKNPSATNQVIDKDGWLSTGDIGWIVPFHSTGRSRNSGGVIVVDGRAKDTIVLST
GENVEPGELEEAAMRSNLIQQIVVIGQDKRRLGAVIVPNKEEVLKAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgattcctatcagctccagcttcaactatgcttccactttctcctattcttct
gttcatgcccttcctcttttctttgctcgccacaacctgacccgggtcaaactttctcga
ccctgttctttccctgtgttttgcctatctgaatccaagacagagaaaacgcagataaga
aggttctccccttttctagaaagttcattgctttctggtaatgatgctgtggcctcagat
gaatggaaaacagttcctgacatttggagatcttctgcccagaagtatggtgataaaata
gccttagtagatccatatcatgatcctccttcaactatgacatacaaacagctggaggac
gcaatattggacttttccgagggcttgagagttattggaataagacctgatgagaagctt
gcgcttttcgctgataattcatgtcgctggcttgtagcagatcaaggtatgatggcatgt
ggagcaatcaatgtggtaaggggttcaaggtcatcaactgaagaactgctgcaaatatac
aaccactctgaaagtgtgggactagctgtggacaaccccgaactgtttaatcggattgca
aaacagttttatttgaaggcttccatgagatatattattttactttggggagaaaaatca
agcctgatcagagaagtagagaaagaggtgccagtctttactttcatggaagtcatacat
ttgggacgagagagtcgcaaggcattgtttggttctcatgatgctcggcagcacttaacg
tatgaagcaataaaatctgatgacattgctacacttatgtacacaagtggaactactgga
aatccaaaaggtgttatgctaacccatcagaatcttttgcatcagattaaaaatttatgt
gacattgtacctgctgaagttggggatagatttctaaccatgctgcctccttggcatgca
tatgaaagagcttgtgaatatttcattttttcatgcggtgttgaacaagtatacacaacc
gtgagaaacttgaaggatgatttgggacgctatcagccacattatttgatttctgttcct
ttagtttatgaaacattatatagtgggatccagaagcagatatctagaagctcccttgtt
agaaagcttgttgcactgacattcataagggtcagcttagggtacatggagtgtaagcgg
atttatgagggtaaatgtctaacaaaggatccgaagtcaccttcctatctctattcggtg
ttggattggttatgggcaagagttattgctgcaatattatttccagttcatatgctggca
aagaaactggtctacagtaaaattcatttagccattggaatattgaaggctggaataagt
ggtggtggtagcttatcttctcatgttgataagttttttgaggccattggtgtgaacgtg
cagaatggatatggtttgacagaaacttcaccagttgttgctgctcggcagcttagttgt
aatgttattggatctgttgggcatccaattaagcatacagagttcaaagttgtagattct
gaaactgatgaagttcttccacctggttcaaaggggattttaaaagtcaggggcccacaa
ttgatgaagggatactacaagaatccttcagctacaaatcaggtcatagataaggatggc
tggctgagtactggtgatataggttggattgttcccttccattcaactgggcgtagtcgt
aattctggtggtgtgattgttgtggatggccgtgctaaagacacgattgtgctttcaaca
ggtgaaaatgttgaaccgggagaactagaagaagctgcaatgaggagtaacctcatacaa
caaattgttgtcattggccaggataagcgacgtctaggagctgtaattgttcctaacaaa
gaagaagtcttaaaggcagcg

DBGET integrated database retrieval system