KEGG   Lotus japonicus: Lj6g3v0294050.1Help
Entry
Lj6g3v0294050.1   CDS       T04348                                 

Gene name
Lj6g3v0294050.1
Definition
(Kazusa) -
  KO
K13265  vestitone reductase [EC:1.1.1.348]
Organism
lja  Lotus japonicus
Pathway
lja00943  Isoflavonoid biosynthesis
lja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    Lj6g3v0294050.1 (Lj6g3v0294050.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.348  (3R)-2'-hydroxyisoflavanone reductase
     Lj6g3v0294050.1 (Lj6g3v0294050.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 NAD_binding_10 GDP_Man_Dehyd NmrA KR Polysacc_synt_2 adh_short
Motif
AA seq 328 aa AA seqDB search
MAERKGKVCVTGGTGFLGSWIIKRLLEDGYAVNTTIRSNPGAKRDVSFLTNLPGASQKLK
IFKADLNIPESFGPAIEGCVGVFHTATPIDFALDEPEEIVTKRTIEGALGILKACLNSKT
VKRVVYTSSGSAVNSFSGKEDEEGLDESSWSDVELLRSVKSFGWLYIVSKPLAEKAVLEF
GEQHGLNVVSLTPTFIVGSWICPQLPGSIAKGLVLILGKKDQIGVTLFHMVHVDDVARAH
IFLLEHLNPKGRYNCSPFTLPIEEMSELLSAKYPEFQIPTVDELKEIKGAKLPSLISKKL
VDAGFEFKHSLEEMFEDAIQCCKERGHL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaggaaagggaaggtttgtgtcactggaggaacagggtttcttggttcatgg
atcatcaagagactccttgaggatggatatgctgttaacaccactattagatctaatcca
ggggctaagagagatgttagcttcctcacaaatctacctggtgcatctcagaagctaaaa
atcttcaaagctgatctcaacatccccgaaagttttggtccagcaattgaaggttgtgtt
ggtgtattccacactgctacaccaattgattttgcattagatgaaccagaggaaatagtg
accaaaagaaccattgaaggagcattaggaattctcaaagcatgcctaaattcaaagact
gtgaagagggttgtttacacttctagtggctctgctgttaattcctttagcggcaaagag
gatgaagaaggattggatgagagttcttggagtgatgtagagttgcttagaagtgtgaaa
tcttttggttggttatatatagtttctaagccattggcagagaaggcagtgcttgaattt
ggggaacaacatgggttgaatgttgtgagtctcacacctacttttattgttggaagctgg
atttgtcctcagcttcctggctcaattgcgaaaggacttgttttgatattaggtaaaaag
gatcaaattggtgtcactcttttccatatggtacatgtggatgatgtagctagagcacat
atattccttcttgaacatcttaatccaaaagggagatataattgctcaccattcacttta
cctattgaagagatgtctgagcttctttcagctaaatacccagaatttcaaataccgaca
gtagacgagttgaaggaaattaaaggtgccaagttgccaagtttaatctcgaagaaactt
gtggatgcgggttttgagtttaagcatagccttgaggaaatgttcgaagatgcaattcaa
tgctgcaaggaaaggggtcatctttaatct

DBGET integrated database retrieval system