KEGG   Lotus japonicus: Ljmtg3v0000680.1Help
Entry
Ljmtg3v0000680.1  CDS       T04348                                 

Gene name
Ljmitog3v0000680.1
Definition
(Kazusa) -
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
lja  Lotus japonicus
Pathway
lja00630  Glyoxylate and dicarboxylate metabolism
lja00710  Carbon fixation in photosynthetic organisms
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
Module
lja_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lja_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
lja_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ljmtg3v0000680.1 (Ljmitog3v0000680.1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ljmtg3v0000680.1 (Ljmitog3v0000680.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ljmtg3v0000680.1 (Ljmitog3v0000680.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large
Motif
AA seq 278 aa AA seqDB search
MRWRDLFLFLFCAEAIYKSQAETGEIKGHYLNATAGTCEEMLKRALFAKELGVPIIMHDY
LTGVFTANTSFAHYCRDNGLLLHIYRAMHAVIDRQKTHGIHFRVLAKALRLSGGDHIHAG
TVVGKLEGEREITFGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVMPVASGGIHVWHMPA
LTEIFWDDSVLQFGGGTLGHPWGNAPGAVANRFALEACVQARNEGRDLAQEGNSILRQAS
KWSPELAAACEVWKEIRFDLKPVWIQMRKKKEIIRRLL
NT seq 838 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggagagaccttttcttattcttattttgtgccgaagcaatttataaatcacag
gctgaaacaggtgaaatcaaaggacattacttgaatgctactgcaggtacatgcgaagaa
atgctaaaaagagcattatttgctaaagaattgggagttcctattataatgcatgactac
ttaacaggggtattcactgcaaatacttcttttgctcattattgccgagataatggtcta
cttcttcacatctaccgtgcaatgcatgcagttattgatagacaaaagactcatggtata
cacttccgtgtactagcgaaagcgttacggctatctggtggagatcatattcacgcgggt
actgtagtaggtaaactagaaggggaaagagagattacttttggctttgttgacttatta
cgcgatgattttgttgaacaagaccgaagtcgtggtatttatttcactcaagattgggtt
tctttacccggtgttatgcctgtggcttcagggggtattcacgtttggcatatgcctgct
ctaaccgagatattttgggatgattccgtactacagttcgggggaggaactttaggtcac
ccttggggtaatgcgccaggtgccgtagctaatcgattcgctctagaagcatgtgtacaa
gctcgtaacgaagggcgtgatcttgctcaggaaggcaattcaattcttcgacaggctagt
aaatggagcccagaactagctgctgcttgtgaggtatggaaagagattcgctttgacttg
aaaccagtgtggatccaaatgagaaaaaagaaagagataataaggaggctcctgtagg

DBGET integrated database retrieval system