KEGG   Lactobacillus jensenii: BUE77_02950Help
Entry
BUE77_02950       CDS       T04677                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lje  Lactobacillus jensenii
Pathway
lje00071  Fatty acid degradation
lje00072  Synthesis and degradation of ketone bodies
lje00280  Valine, leucine and isoleucine degradation
lje00310  Lysine degradation
lje00362  Benzoate degradation
lje00620  Pyruvate metabolism
lje00630  Glyoxylate and dicarboxylate metabolism
lje00640  Propanoate metabolism
lje00650  Butanoate metabolism
lje00900  Terpenoid backbone biosynthesis
lje01100  Metabolic pathways
lje01110  Biosynthesis of secondary metabolites
lje01120  Microbial metabolism in diverse environments
lje01130  Biosynthesis of antibiotics
lje01200  Carbon metabolism
lje01212  Fatty acid metabolism
lje02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUE77_02950
   00630 Glyoxylate and dicarboxylate metabolism
    BUE77_02950
   00640 Propanoate metabolism
    BUE77_02950
   00650 Butanoate metabolism
    BUE77_02950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUE77_02950
   00072 Synthesis and degradation of ketone bodies
    BUE77_02950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUE77_02950
   00310 Lysine degradation
    BUE77_02950
   00380 Tryptophan metabolism
    BUE77_02950
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUE77_02950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUE77_02950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BUE77_02950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lje04147]
    BUE77_02950
Enzymes [BR:lje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BUE77_02950
Exosome [BR:lje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUE77_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APT14416
Position
595070..596215
Genome map
AA seq 381 aa AA seqDB search
MQDIYIIAAKRTPFGRYRGQLAAFNAVELGTYALKDALKAANLRSSDLDALFMGNVLSAG
LGQNMARQVAINSGMREESVATTINEVCGSSLKAVRLAQAQMLIGDLDLVAVGGSESMTN
APLLAKKSEKDNPNFVDSMLNDGLTDSFSNKLMGNTCENVAVKYGISRAEADEFSVNSHQ
KAARAQAAGFFNQEITPLAELDHDENVRPDSNVEKLASLKTVFKEGGVATAGNSSPLSDG
ASMLILATEDKVKELNLKPLAKLTAYAEVGLDPQIMGFGPKVVIEKLLQENGQTLADIDL
FEINEAFAATSLAVEKELHLDHSKVNIHGGALALGHPLGASGARILGTLAHSLISENKER
GIASLCIGGGLAIAFEIERGK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacatttatattatcgccgcaaagagaacaccttttggtcgttatcgtggtcag
ttagcagcttttaatgccgtagagttagggacttatgcccttaaagacgccttgaaggct
gctaatttgcgttctagtgacttagatgccttatttatgggaaatgttttaagtgcagga
cttggacagaatatggctcgtcaagttgctattaatagcgggatgagagaagaaagtgtt
gctacaacaattaatgaagtatgtggatcttcacttaaggctgttcgtttagcccaagct
caaatgcttattggcgatttagatcttgtcgcagttggtggtagtgagagtatgactaat
gcgccacttctagctaaaaaatccgaaaaagataatcccaattttgttgatagtatgctc
aatgatggtctaactgattcatttagcaacaagttaatgggaaatacttgtgaaaatgtc
gctgttaaatatgggataagtcgcgctgaagcagatgaatttagtgtgaattcacatcaa
aaagcagctcgcgcacaagctgctggcttctttaatcaagaaattactcctttggcagaa
ttagatcatgatgaaaatgtacggccagattcaaatgttgaaaagttagctagtttgaag
acggtctttaaagaaggtggtgttgctacagctggtaactcatcacctttatcagatggg
gcaagtatgttaattttagctactgaagataaggttaaagaattgaacttaaagccactt
gccaagttaactgcctatgctgaagtggggcttgatccacaaattatgggctttggtcct
aaagtggttattgagaaattattgcaagaaaatgggcaaactctagctgatattgacttg
tttgaaattaatgaagcttttgctgcaactagtctagctgttgaaaaagaattgcacttg
gatcatagtaaggttaatattcatggtggagccttagcattgggacatccattaggagca
agtggtgcgagaattttaggtactttagctcattctttaattagtgaaaataaagaaaga
ggaattgccagcctttgtattggaggcgggctagcaattgcctttgagattgaacggggg
aaataa

DBGET integrated database retrieval system