KEGG   Lactobacillus jensenii: BUE77_04120Help
Entry
BUE77_04120       CDS       T04677                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lje  Lactobacillus jensenii
Pathway
lje00670  One carbon pool by folate
lje00790  Folate biosynthesis
lje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BUE77_04120
   00670 One carbon pool by folate
    BUE77_04120
Enzymes [BR:lje01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BUE77_04120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 DUF4788
Motif
Other DBs
NCBI-ProteinID: APT14635
Position
841997..842500
Genome map
AA seq 167 aa AA seqDB search
MISFVWAEDNQHQIGYQGHLPWHLPADLAHFKEKTMGKTMVMGKNTFLSLPFVLPKRKHL
VLTHDEALIEKFQNNSQVDFVTSMKQLREYLSAHKEEQIAVIGGVSVFEGLKDIVDCLEK
TEIDGIFKADTTMPAIDYSAFKLIKRETFTADENNPYDYSFLTYLRK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatcagttttgtctgggctgaagataatcagcatcaaattggctatcagggacatctt
ccttggcatttaccagctgatttagcacattttaaagaaaaaacaatgggcaagacgatg
gtgatggggaagaacacttttctcagtttgccatttgttttaccgaagcgaaagcacttg
gtattaacacacgatgaagcactaattgagaaatttcaaaataacagtcaagtagatttt
gtcacttctatgaagcaattaagagagtacttgtccgctcataaagaagaacagatagct
gttattggtggtgtgagtgtgtttgaaggattgaaagatattgtagattgccttgaaaaa
accgagattgatggaatttttaaggccgatactacaatgccagcaattgactattcagca
tttaaattaataaaaagagaaacgtttacagctgatgaaaataatccatatgattacagc
tttttaacctatcttagaaagtag

DBGET integrated database retrieval system