KEGG   Lactobacillus johnsonii FI9785: FI9785_1399Help
Entry
FI9785_1399       CDS       T01120                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00900  Terpenoid backbone biosynthesis
ljf01110  Biosynthesis of secondary metabolites
ljf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FI9785_1399 (mvaA)
Enzymes [BR:ljf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     FI9785_1399 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CAX67259
UniProt: D0R596
Position
complement(1324196..1325431)
Genome map
AA seq 411 aa AA seqDB search
MKLEESSKKKFYQWLPEERRAFLTEKGIKLSEIDSETLERLDKLSENVIGQVRLPLGVLP
KLIVNGKDYQVPMAVEEPSVVAAANHAAKIFNQNGGAVADSKRNGIYGQIVLEVTDNFDL
TKFTTEFSQLIRLANKKFVSLVKHGGGVRKIEASQKENLVFLRVLVDPAEAMGANKTNAI
LEFLGNELEKQPDIEQTLYAILSNYPTQLTSAKVSLSIDSVGGLKVAKKIALLSKIGQAD
IYRAVTNNKGIMNGIDSVLVATGNDYRGVEAATAVWANKNGAYTSLSKWKIEEDRLVGTV
TVPLAIGVVGGSIKARRDIQQSFSLLGNISAKQLAEVIATTGLANNFSALLAISTKGIQA
GHMKLQARNLVATLKASKGEKAIVLKKLQESKKYTQEAAFEFLNKIRKDQK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagaagaatcatctaaaaagaaattttatcaatggttgccagaggaaagaaga
gcctttttaaccgaaaaaggaattaaactaagtgagattgattctgaaactttggaaaga
ctagataaacttagtgaaaatgtaattggtcaagtccgtcttcctcttggtgtgcttccc
aagttaatagttaacgggaaagattatcaagtaccaatggccgtagaagaaccatccgtt
gttgcagcagcaaaccatgcagctaaaatttttaatcaaaatggtggagcagtagctgat
agtaaacgaaatggaatatatggtcaaattgttttagaggtaaccgataatttcgattta
actaagtttactactgaattttctcaattaattagattagctaataaaaaattcgttagt
ttagttaagcatggtggaggagttcgtaaaattgaagcttctcaaaaagaaaatttagtt
tttcttagagttttggttgacccagcagaagctatgggagctaataagacaaatgctatt
ttagaatttttaggaaatgaattagagaagcagccagatattgaacaaactctgtatgca
attttgtctaattatcctacgcaattgactagtgctaaagtaagtctttcaattgacagt
gtaggaggattaaaagttgctaaaaagatagctttattaagtaaaataggacaagctgat
atttaccgggcagtgactaataataaaggaattatgaatggtattgatagtgtattagtt
gcaactggtaatgattatcgcggagttgaagcagcaactgctgtttgggctaataaaaat
ggtgcctatacatctttgagtaagtggaaaattgaagaagatagattagtggggactgta
acagttcccttagcaataggtgtagtaggtggttcaattaaggctcgtcgagacattcag
caaagctttagtttattaggtaatatatctgccaagcaactagcagaagttattgcgacc
acaggcttagcaaataacttttcagctcttttagcaatttctactaagggaattcaagct
gggcatatgaaattgcaggcgagaaatttagtagcaaccttaaaagctagtaaaggtgaa
aaagcaatagttttaaaaaaattgcaggaaagtaaaaaatatactcaagaagcagctttt
gaatttttaaacaaaataagaaaggatcaaaaataa

DBGET integrated database retrieval system