KEGG   Lactobacillus johnsonii FI9785: FI9785_1400Help
Entry
FI9785_1400       CDS       T01120                                 

Gene name
mvaC
Definition
(GenBank) mvaC
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00071  Fatty acid degradation
ljf00072  Synthesis and degradation of ketone bodies
ljf00280  Valine, leucine and isoleucine degradation
ljf00310  Lysine degradation
ljf00362  Benzoate degradation
ljf00620  Pyruvate metabolism
ljf00630  Glyoxylate and dicarboxylate metabolism
ljf00640  Propanoate metabolism
ljf00650  Butanoate metabolism
ljf00900  Terpenoid backbone biosynthesis
ljf01100  Metabolic pathways
ljf01110  Biosynthesis of secondary metabolites
ljf01120  Microbial metabolism in diverse environments
ljf01130  Biosynthesis of antibiotics
ljf01200  Carbon metabolism
ljf01212  Fatty acid metabolism
ljf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FI9785_1400 (mvaC)
   00630 Glyoxylate and dicarboxylate metabolism
    FI9785_1400 (mvaC)
   00640 Propanoate metabolism
    FI9785_1400 (mvaC)
   00650 Butanoate metabolism
    FI9785_1400 (mvaC)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FI9785_1400 (mvaC)
   00072 Synthesis and degradation of ketone bodies
    FI9785_1400 (mvaC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FI9785_1400 (mvaC)
   00310 Lysine degradation
    FI9785_1400 (mvaC)
   00380 Tryptophan metabolism
    FI9785_1400 (mvaC)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FI9785_1400 (mvaC)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FI9785_1400 (mvaC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FI9785_1400 (mvaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljf04147]
    FI9785_1400 (mvaC)
Enzymes [BR:ljf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FI9785_1400 (mvaC)
Exosome [BR:ljf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FI9785_1400 (mvaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAX67260
UniProt: D0R597
Position
complement(1325409..1326575)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKNKSAVDLGVLALKGLLKKNIVPQDKIDSILVGNVLSA
GLGQNVARQIALKSGLPESVVGTSVDDVCGSSLKALRFAQGQMLLGDSQIAIVGGAESMT
NAPLLLDKSKKHDENPAYQDSLMIDGIGDAYSRKPMGITAENVADKYHITRQDMDEFARD
SHAKAYAAQENNWFEEEYAPIELDGNVLDHDETIRPDSSLEALGQLKPVFKENGRVTAGN
SSPLTDGASMLLLSNQQKLDELNLTPLAYLGAYAEIGCDPAYMGYAPYFAIKELLTKTNS
TIEDYDLIEINEAFAAQAYAVARDLNIPKEKLNIAGGAISLGHPLGATGTRLVMSAVNGL
RKINGRRAIVSLCIGGGQGIAYEIRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaggatgtttatatagtaggaatgaatcgaattccttttggtaagtatcgtgga
ttttataagaataaaagtgctgttgacctaggagtattagcacttaagggattattgaaa
aagaatattgttccacaagataaaatagatagcattttggtgggaaatgtattaagtgct
gggctaggtcaaaatgtcgctcgacaaatagctttaaaatcaggtttacctgaatctgta
gtgggtactagcgtagacgatgtttgtggttcaagtttaaaggcattacggtttgctcaa
ggtcaaatgctcctaggagattctcaaattgcaattgtaggtggggcagaaagtatgaca
aatgcaccacttttacttgataaaagtaaaaagcatgatgaaaatccagcatatcaagat
agtttaatgatagatggaattggggatgcttattcgagaaagccaatgggaattacagct
gagaatgtagctgataaataccatattacgcgtcaagatatggatgaatttgcgcgtgat
tcccacgccaaggcttatgcagctcaagagaacaactggtttgaggaagagtatgcacca
attgaactcgatggtaatgttcttgatcatgatgaaaccattcgaccagattctagttta
gaagcattaggtcaattaaaacctgtatttaaagaaaatggacgagttacggctggtaat
tcttctccgctaactgatggtgcaagtatgttgttattatctaatcaacaaaaattagat
gagttaaatttaaccccattagcatacctaggtgcctatgcagaaattggctgtgatcct
gcctatatgggctatgcgccatactttgccattaaagaattacttacaaaaactaatagc
acaattgaagattacgatcttattgaaattaatgaagcctttgcagctcaagcatatgct
gtagcccgtgatctaaatattccaaaagaaaaattaaatatcgctggaggagcaattagt
ttaggacatccgcttggtgcaaccggtacgcgcttggtaatgagtgcagtaaatggtttg
cgcaaaattaatggtcgaagagcaattgtatctctatgtatcggcggtggccaaggaatc
gcatatgaaattagaagaatcatctaa

DBGET integrated database retrieval system