KEGG   Lactobacillus johnsonii FI9785: FI9785_1689Help
Entry
FI9785_1689       CDS       T01120                                 

Definition
(GenBank) hypothetical protein
Organism
ljf  Lactobacillus johnsonii FI9785
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF900
Motif
Other DBs
NCBI-ProteinID: CAX67542
UniProt: D0R629
Position
complement(1623626..1624252)
Genome map
AA seq 208 aa AA seqDB search
MDLLLVRHGVSEHNTSDVISGGTSNPNLSQAGVKQVEEVSKLIDNSKLDRVYASPLIRAK
RTAQILTDFQKEIITDDRLREMNFGSWDGQHAEELKIKYPDAFDDLGTINSKYAEYAENG
ETFSQVADRVEEFLSEIQPDANDKTIMIVCHGFVIRSLIARWFKLKIEDVMTVRNVSFTE
LHFEKNDIERPRLMTFNRTEPLYYGLKR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttattagtaagacatggggttagtgaacataatacttcagatgtgatctcc
ggcggtactagtaaccctaacttaagccaagcaggtgttaaacaagtagaagaagtaagt
aagttaattgacaatagtaaacttgatcgagtatatgcaagcccattaattagagctaaa
agaacagcacaaattttaactgattttcaaaaagagattattactgatgatcgacttaga
gaaatgaattttggctcttgggacggccaacatgccgaagagctgaagataaaatatcct
gatgccttcgatgatttaggaactattaatagtaaatatgcagaatacgctgaaaatggt
gaaacttttagtcaagtagcagatcgagttgaagaatttttatctgagattcaacccgat
gctaatgacaagacaattatgattgtttgtcacggatttgtgattaggagtttaatagct
cggtggtttaaactaaaaattgaagatgtaatgacagtaagaaatgttagttttactgag
cttcattttgaaaaaaatgatattgagcgaccaagattaatgacctttaatcggacggaa
cccttgtattacggacttaagaggtaa

DBGET integrated database retrieval system