KEGG   Lactobacillus johnsonii DPC 6026: LJP_0677Help
Entry
LJP_0677          CDS       T01960                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00230  Purine metabolism
ljh01100  Metabolic pathways
Module
ljh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LJP_0677
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LJP_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_33 Rad17 RsgA_GTPase AAA
Motif
Other DBs
NCBI-ProteinID: AEB93008
UniProt: F4AGH6
Position
740708..741322
Genome map
AA seq 204 aa AA seqDB search
MAHQGLLLVLSGPSGVGKGTVKSAMVKQKAFSFEYSVSMTTRKPRPGEVNGKDYYFVSED
RFQEAIKGNELLEYNEYVGNHYGTPLAPVQKMLNEGKDVLLEIDVNGAKQVRKLMPDGVF
IFLTPPDLHELKHRIVNRGTDSDKVIAMRMKQARKEILMMEDYDYAVVNDTVANAVDHIK
SIVEAEHVRVPRVINDYRNMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcaaggtttattattagttttatctggtccttctggcgttggtaaggggacc
gttaaaagtgcaatggtgaagcaaaaagctttttcatttgaatattctgtttcaatgact
actcgtaagcctcgtccaggcgaagttaatgggaaggattattattttgtttcagaggac
cgtttccaagaagcaattaaaggtaacgagcttttggaatataatgaatatgtaggcaac
cattatggtactccacttgcaccagtgcaaaagatgctcaatgaaggtaaagatgtttta
cttgaaattgatgtcaatggagcaaaacaggttcgcaagttaatgccagatggcgtcttt
atctttttgacaccaccagatttgcatgaattaaaacatcgaattgttaatcgcgggact
gattctgacaaggtaattgccatgagaatgaaacaggcacgtaaagagattttaatgatg
gaagattatgattatgctgtagttaacgatactgttgctaatgcggtggatcatattaag
tctattgttgaagctgaacacgtgcgtgtaccgcgagtaattaacgattatagaaatatg
gttaaggaggattaa

DBGET integrated database retrieval system