KEGG   Lactobacillus johnsonii DPC 6026: LJP_1085cHelp
Entry
LJP_1085c         CDS       T01960                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00010  Glycolysis / Gluconeogenesis
ljh00030  Pentose phosphate pathway
ljh00051  Fructose and mannose metabolism
ljh00052  Galactose metabolism
ljh00680  Methane metabolism
ljh01100  Metabolic pathways
ljh01110  Biosynthesis of secondary metabolites
ljh01120  Microbial metabolism in diverse environments
ljh01130  Biosynthesis of antibiotics
ljh01200  Carbon metabolism
ljh01230  Biosynthesis of amino acids
ljh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_1085c
   00030 Pentose phosphate pathway
    LJP_1085c
   00051 Fructose and mannose metabolism
    LJP_1085c
   00052 Galactose metabolism
    LJP_1085c
  Energy metabolism
   00680 Methane metabolism
    LJP_1085c
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LJP_1085c
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LJP_1085c
Protein phosphatases and associated proteins [BR:ljh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LJP_1085c
Messenger RNA biogenesis [BR:ljh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LJP_1085c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEB93408
UniProt: F4AEY5
Position
complement(1172063..1173022)
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADK
ISRGGTFLYSARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTSHGYNAI
GLPGSIDNDIPYTDYTIGFDTACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHV
GVATGADAIVIPEEPYDIKEIAENLKQGFANGKKHGIVVLAEGVMDAEKFKDELLKYGDF
DARANVLGHMQRGGSPTMRDRVVASEMGAYAVKLLLEGKGGLAVGMENNKLTHHDILDLF
DAKHHGNYALYSLNKDLAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagatgcccctggtatgaacgctgccatt
agagctgttactcgtacagctttggcaaacggtatcgaagtttgcggaattcgttatgga
tatgctggtttagttgctggtgatattttccaaatgacttctgaaacagttgcggataaa
attagccgcggcggtacttttctttattcagctcgtttcccagaatttaaggaagaagaa
gttcaacttaagggaatcgaacaattaaagaagcacggaatcgatgctttagttgtcatt
ggtggtgatggttcttaccacggtgcattgaagcttacaagccatggctataatgctatt
ggtcttcctggttcaattgacaacgatattccttatactgattacacaattggttttgac
actgcatgtaatactgcaatggaagccattgataagattcgtgacactgcaacaagtcac
caacgtgtatttgttgtaaatgttatgggtcgtgattgtggggatatcgcaatgcacgtt
ggtgttgctaccggtgctgacgcaattgttattccagaagaaccttatgacattaaggaa
attgctgaaaacttgaagcaaggatttgctaatggtaagaaacatggaatcgttgtttta
gctgaaggtgttatggacgctgaaaaatttaaggatgaacttcttaaatatggtgacttt
gacgctcgtgctaatgtattgggccatatgcaacgtggcggaagcccaacaatgcgtgac
cgtgtagtagcaagtgaaatgggtgcctacgctgttaagttattacttgaaggtaaaggc
ggcttagctgttggtatggaaaacaacaagcttactcaccatgatattcttgatttgttt
gatgcaaaacaccacggtaattatgcgttatactcattaaacaaagacttagccaagtag

DBGET integrated database retrieval system