KEGG   Lactobacillus johnsonii DPC 6026: LJP_1291cHelp
Entry
LJP_1291c         CDS       T01960                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00010  Glycolysis / Gluconeogenesis
ljh00052  Galactose metabolism
ljh01100  Metabolic pathways
ljh01110  Biosynthesis of secondary metabolites
ljh01120  Microbial metabolism in diverse environments
ljh01130  Biosynthesis of antibiotics
Module
ljh_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJP_1291c
   00052 Galactose metabolism
    LJP_1291c
Enzymes [BR:ljh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LJP_1291c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEB93613
UniProt: F4AG70
Position
complement(1386815..1387801)
Genome map
AA seq 328 aa AA seqDB search
MKTSFRKYSRKNGQDLCEISLENNQGMKVKILNYGATLEKVLLDGEDMILSLNSPEDYSK
ERNFLGGTVGRICGRVRLGQWKHGNQIYQLPQNDGENHIHGGIGTDMKIWNFKLKNSEQE
SRVDLFLFDPDGDNGYPGNMKLYATYKLDNENNLSYKLEAVSDQLTIFNPANHTYFNLGE
RATDLKLQLAADYYLPVGTDGLPNQGMKNVENTVFDFRQGKKISAALDSDDSQINLRNGL
DHPFILNGMQPAAVLSSNKHKMIMTTNAPAIVTYTANHFNHTGVANNIGQYDGITLEAQY
PPAEGIELGEITLLPFEKFERKINWNFS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagttttagaaagtatagtcgtaaaaatggtcaggacttatgtgaaattagt
cttgaaaataatcaaggaatgaaggttaagattcttaattatggagcaactttagaaaaa
gttctacttgatggcgaagatatgattttgtcattaaatagtccagaagattattcaaaa
gaaagaaattttctgggtgggaccgttggcagaatttgtggacgcgttcggctaggtcaa
tggaaacatggcaaccaaatatatcaacttcctcaaaatgatggagaaaaccacattcat
ggtggtattggaactgatatgaaaatctggaactttaaattaaaaaattcagaacaagag
tctcgagttgatctctttctttttgatccagatggagataatggctatcccggcaacatg
aagttatatgccacttataagcttgataatgaaaataacttgtcatacaaattagaagct
gttagtgatcagttaacaatttttaatccggctaatcatacatatttcaacttaggtgaa
agagctaccgacttaaaactccaacttgcagcggattactatttgccagtaggtacggat
ggattgccaaatcaaggaatgaaaaatgtagagaatacagtgtttgattttagacaaggt
aagaagatatctgctgctttagatagtgatgatagtcaaattaacttgcgtaacggtcta
gatcatccttttattttgaatgggatgcagcctgcagcagtgttgtcatctaataaacac
aaaatgattatgaccactaatgcaccagcaattgttacttatacagctaaccattttaat
catactggtgtagcaaacaatattggacagtacgatggaattactttagaagcacaatat
ccaccagcagaaggtatagagttaggagaaattactttactcccttttgaaaagtttgag
cgtaagattaactggaactttagttaa

DBGET integrated database retrieval system