KEGG   Lactobacillus johnsonii DPC 6026: LJP_1348cHelp
Entry
LJP_1348c         CDS       T01960                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00071  Fatty acid degradation
ljh00072  Synthesis and degradation of ketone bodies
ljh00280  Valine, leucine and isoleucine degradation
ljh00310  Lysine degradation
ljh00362  Benzoate degradation
ljh00620  Pyruvate metabolism
ljh00630  Glyoxylate and dicarboxylate metabolism
ljh00640  Propanoate metabolism
ljh00650  Butanoate metabolism
ljh00900  Terpenoid backbone biosynthesis
ljh01100  Metabolic pathways
ljh01110  Biosynthesis of secondary metabolites
ljh01120  Microbial metabolism in diverse environments
ljh01130  Biosynthesis of antibiotics
ljh01200  Carbon metabolism
ljh01212  Fatty acid metabolism
ljh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJP_1348c
   00630 Glyoxylate and dicarboxylate metabolism
    LJP_1348c
   00640 Propanoate metabolism
    LJP_1348c
   00650 Butanoate metabolism
    LJP_1348c
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LJP_1348c
   00072 Synthesis and degradation of ketone bodies
    LJP_1348c
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJP_1348c
   00310 Lysine degradation
    LJP_1348c
   00380 Tryptophan metabolism
    LJP_1348c
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJP_1348c
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LJP_1348c
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJP_1348c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljh04147]
    LJP_1348c
Enzymes [BR:ljh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LJP_1348c
Exosome [BR:ljh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJP_1348c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEB93670
UniProt: F4AGC7
Position
complement(1452059..1453225)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKDKSAVDLGVLALKGLLKKNIVPQDKIDSILVGNVLSA
GLGQNVARQIALKSGLPESVVGTSVDDVCGSSLKALRFAQGQMLLGDSQIAIVGGAESMT
NAPLLLDKSKKHDENPAYQDSLMIDGIGDAYSRKPMGITAENVADKYHITRQDMDEFARD
SHAKAYAAQENDWFKEEYAPIELDGHVLDHDETIRPDSSLEALGQLKPVFKENGRVTAGN
SSPLTDGASMLLLSNQQKLDELNLTPLAYLGAYAEIGCDPAYMGYAPYFAIKELLTKTNS
TIEDYDLIEINEAFAAQAYAVARDLNIPKEKLNIAGGAISLGHPLGATGTRLVMSAVNGL
RKINGRRAIVSLCIGGGQGIAYEIRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaggatgtttatatagtaggaatgaatcgaattccttttggtaagtatcgtgga
ttttataaggataaaagtgctgttgacctaggagtgttagcacttaagggattattgaaa
aagaatattgttccacaagataaaatagatagcattttggtgggaaatgtattaagtgct
gggctaggtcaaaatgttgctcgacaaatagctttaaaatcagggttacctgagtctgta
gtgggtactagcgtagacgacgtttgtggttcaagtttaaaggcattacggtttgctcaa
ggtcaaatgctcctaggagattctcaaattgcaattgtaggtggggcagaaagtatgaca
aatgcaccacttttacttgataaaagtaaaaagcatgatgaaaatccagcatatcaagat
agcttaatgatagatggaattggggatgcttattcgagaaagccgatgggaattacagct
gagaatgtagctgataaataccatattacgcgtcaagatatggatgaatttgcacgtgat
tctcatgccaaggcttatgcagctcaggagaatgactggtttaaggaagaatatgcacca
attgaactcgatggtcatgttcttgatcatgatgaaaccattcgaccagattctagttta
gaagccctaggtcaattaaaacctgtatttaaggaaaatggacgagttacggctggcaat
tcttcaccgttaactgatggtgcaagtatgttgttattatctaatcaacaaaaattagat
gagttaaatttaaccccattagcatacctaggtgcctatgcagaaattggctgtgatcct
gcctatatgggctatgcgccatactttgccattaaagaattacttacaaaaactaatagc
acaattgaagattacgatcttattgaaattaatgaagcctttgcagctcaagcatatgct
gtagcccgtgatctaaatattccaaaagaaaaattaaatatcgctggaggagcaattagt
ttaggacatccgcttggtgcaaccggtacgcgcttggtaatgagtgcagtaaatgggttg
cgtaaaattaatggtcgaagagcaattgtatctctatgtatcggcggtggccaaggaatc
gcatatgaaattagaagaatcatctaa

DBGET integrated database retrieval system