KEGG   Lactobacillus johnsonii DPC 6026: LJP_1608cHelp
Entry
LJP_1608c         CDS       T01960                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ljh  Lactobacillus johnsonii DPC 6026
Pathway
ljh00230  Purine metabolism
ljh01100  Metabolic pathways
Module
ljh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ljh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LJP_1608c
Enzymes [BR:ljh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LJP_1608c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 ADK AAA_17 Thymidylate_kin SKI PRK AAA_33 MMR_HSR1 ABC_tran AAA_5 LacI AAA_16 RsgA_GTPase dNK AAA_28 AAA_24 AAA_14 AAA DUF1100 Rad17 Cytidylate_kin RNA_helicase NTPase_1 CbiA AAA_30
Motif
Other DBs
NCBI-ProteinID: AEB93924
UniProt: F4ACP6
Position
complement(1753404..1753961)
Genome map
AA seq 185 aa AA seqDB search
MQRIIIIAGPSGVGKTTVSKYLTEKYNIPRVVTHTTRPVRQGEIPGKSYYFETDESFKKL
HFFEHVKYGEYQYGSSKEALEKAWAKNDLVSLIVETDGVKSYLEKLGKQAYFIYLTVSDF
SVLKKRLLGRGDKASEIDKRLNSFEFKRDLHLSDELAKKAHVLNNDNWEKTAKELDKIVK
KLENK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagaattatcataattgcgggaccaagtggagtaggaaagacaacagtctcaaaa
tacttaacggaaaaatataatattccgcgtgtagtaacacatactactaggccagttaga
caaggagaaattccggggaagtcatattattttgaaactgatgagagttttaaaaaactt
catttctttgaacatgtaaaatatggggaatatcaatatggatccagtaaagaagcttta
gaaaaagcctgggcaaagaatgacttggtttctttaattgttgagactgacggagttaag
tcctatttagaaaaattaggaaagcaagcatattttatttatttaactgtttcagatttt
tcagttctaaaaaagcgattattaggacgcggagataaagctagtgaaattgataaaaga
ttaaatagttttgaatttaagcgtgatttacatttgtcagatgaacttgctaaaaaagca
catgtattaaataatgacaactgggaaaagacagctaaagaactcgataagatcgtaaaa
aagctggaaaataaatag

DBGET integrated database retrieval system