KEGG   Lactobacillus johnsonii N6.2: T285_01130Help
Entry
T285_01130        CDS       T02941                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00450  Selenocompound metabolism
ljn00970  Aminoacyl-tRNA biosynthesis
ljn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    T285_01130
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T285_01130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ljn01007]
    T285_01130
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ljn03016]
    T285_01130
Enzymes [BR:ljn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     T285_01130
Amino acid related enzymes [BR:ljn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   T285_01130
Transfer RNA biogenesis [BR:ljn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    T285_01130
 Prokaryotic type
   Other AARSs
    T285_01130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AHA96710
UniProt: V5P1W6
Position
250152..252128
Genome map
AA seq 658 aa AA seqDB search
MAEKKTFYITTPIYYPSGKLTIGNAYTTIAADTMTRYKKSRGFDTFFLTGTDEHGLKIEQ
KAEAQGIKPQKFVDKMADSYKDLWKMLDVSYDRFIRTTDEDHVKAVQKIFERLLKQGDIY
LGEYTGWYSVEDEEYFTESQLAEVYRDDDGNVIGGKAPSGHEVRLVKEPSYFFRMSKYAD
RLLQYYKDHPDFILPHSREKEMVNNFIKPGLEDLSVTRTTVDWGIPVPSDPKHVVYVWID
ALSNYITALGYGSDNDALFKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQIFGH
GWVLMRDGKMSKSKGNAVYPEMIVKRYGLDALRYYLMRAIPFGSDGIFTPEDFVERVNFD
LANDLGNLLNRTVSMINQYQDGQVAPVASEQDEFAKDLIKTANETIAEYQKQMDALHFSQ
ALDSVWKLISRANKYIDETTPWTLNKEGKSEELSKVMTNLAESLRLIAILIAPVMTQSPV
KMFEQLGLDWKNDDQKKLDFGGFDWNIKVTEKPTPIFPRLKNDVEVKYIKEEMKKAKPKK
KTRSQQKEEKHITIDDFDKVKIQVGQILSVESVKGSSKLLMFKLDFGDGNERQILSGIRK
FYPDASELLDKKVLAVTNLKPRKMLGHESQGMLLSSEKDGKVKLAIVGDEHEVGAELG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagaaaactttctatattactacacctatttactatccatctggaaaatta
actatcggtaatgcatacactactattgctgctgataccatgactcgttataaaaaatct
cgcggttttgatacattcttcttaactggaactgatgaacatggacttaagattgagcaa
aaagctgaagcacaaggaattaaaccacaaaaatttgtagataaaatggctgattcctat
aaggacctatggaaaatgttagacgtttcttatgatcgcttcattagaacaactgatgaa
gatcacgttaaagctgtacaaaagatttttgaaagattattaaaacaaggagatatttac
ttaggcgagtacactggttggtattctgtagaagatgaagaatacttcactgaatcacaa
cttgctgaagtatatagagatgatgatggcaatgtgattggcggaaaggctccatcagga
catgaagtacgtttagttaaggaaccatcatacttcttcagaatgagtaaatatgctgat
cgcttacttcaatactacaaggatcacccagactttattttgcctcactctcgtgagaaa
gaaatggtaaataactttattaagccaggcttagaagacttatctgtcactcgtacgact
gttgattggggaattcctgtgcctagtgatcctaagcatgttgtttatgtttggattgat
gctctttctaactatattactgctcttggatatggttcagataatgatgcattatttaag
aaatattggccagctgatgtacatttagttggtaaggaaattgttcgcttccacactatt
tattggccaattatgttaatggcacttgatcttcctcttccaaagcaaatctttgggcat
ggctgggtattaatgagagacggtaaaatgtctaaatcaaagggtaatgccgtttaccca
gaaatgattgttaaacgttatggcttagatgctcttcgttattacttgatgcgtgcaatt
ccatttggttcagatggtatttttactccggaagattttgttgaaagagttaactttgat
ttggctaatgacttaggtaacttgttaaatagaactgtttcaatgattaatcaatatcaa
gatggccaagttgctccagttgcttcagaacaagatgaatttgcaaaagatttaattaaa
acagctaatgaaacaattgctgaatatcaaaaacaaatggatgccctccacttctctcaa
gctttagatagtgtttggaagctcatttctcgtgcaaataaatatattgatgaaactaca
ccttggacgttaaataaagagggcaagagtgaagaactatctaaagtaatgactaacttg
gctgaaagtttacgtttaattgcaattttaattgcaccagttatgacgcagagcccagtt
aagatgtttgaacaactcggacttgactggaagaatgatgatcaaaagaaacttgatttt
ggcggctttgactggaacattaaggtaacagaaaagccgactccaatcttcccacgactt
aaaaatgatgttgaagttaagtacattaaggaagaaatgaagaaggctaagccaaagaag
aagactagaagtcaacaaaaagaagaaaaacacattacaattgatgattttgacaaagtc
aaaattcaagtaggtcaaattttatccgttgagtcagtaaagggatcaagtaaattatta
atgtttaaacttgattttggtgatggaaacgaacgtcaaattttaagtggtattcgtaag
ttttatcccgatgcaagtgaacttttagataaaaaggtccttgcagttactaacttaaag
ccacgtaagatgctaggacatgaaagtcaaggtatgcttttatctagtgaaaaggatggc
aaggttaagttagctattgttggcgatgaacatgaggttggagctgaattaggctaa

DBGET integrated database retrieval system