KEGG   Lactobacillus johnsonii N6.2: T285_06780Help
Entry
T285_06780        CDS       T02941                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00900  Terpenoid backbone biosynthesis
ljn01110  Biosynthesis of secondary metabolites
ljn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ljn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T285_06780
Enzymes [BR:ljn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     T285_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AHA97717
UniProt: V5P3U1
Position
complement(1401320..1402555)
Genome map
AA seq 411 aa AA seqDB search
MKLEESSKKKFYQWLPEERRAFLTEKGIKLSEIESETLERLDKLSENVIGQVRLPLGVLP
KLIVNGKDYQVPMAVEEPSVVAAANHAAKIFNQNGGAVADSRRNGIYGQIVLEVTDNFDL
TKFTTEFPQLISLANKKFVSLVKHGGGVRKIEASQKENLVFLRVLVDPAEAMGANKTNAI
LEFLGNELEKQPDIEQTLYAILSNYPTQLTSAKVSLSIDSVGGLKVAKKIALLSKIGQTD
IYRAVTNNKGIMNGIDSVLVATGNDYRGVEAATAVWANKNGAYTSLSKWKIEEDRLVGTV
TVPLAIGVVGGSIKARRDVQQSFSLLGNISAKQLAEVIATTGLANNFSALLAISTKGIQA
GHMKLQARNLVATLKASEGEKAIVLKKLQESKKYTQEAAFEFLSEIRKDQK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagaagaatcatctaaaaagaaattttatcaatggttaccggaggaaagaaga
gcctttttaactgaaaaaggaattaaactaagtgagattgagtctgaaactttggaaaga
ctagataaacttagtgaaaatgtaattggtcaagtccgtcttcctcttggtgtgcttcct
aagttaatagttaacgggaaagattatcaagtaccaatggccgtagaagaaccatcggtt
gttgcagcagcaaaccatgcagctaaaatttttaatcaaaatggtggagcagtagctgat
agtagacgaaatggaatatatggtcaaattgttttagaggtaactgataattttgattta
actaagtttactactgaatttcctcaattaattagcttagctaataaaaaattcgttagc
ttagtcaagcatggtggaggagttcgtaaaattgaagcttctcaaaaagaaaatttagtt
tttcttagagttttggttgacccagcagaagctatgggagctaataaaacaaatgctatt
ttagaatttttaggaaatgaattagagaagcagccagatattgaacaaactctgtatgca
attttgtctaattatcctacgcaattgactagtgctaaagtaagtctttcaattgacagt
gtaggaggattaaaagttgctaaaaagatagctttattgagtaaaataggacaaactgat
atttaccgggcagtgactaataataaaggaattatgaatggtattgatagtgtattagtt
gcaactggtaatgattatcgtggagttgaagcagcaactgctgtttgggctaataaaaat
ggtgcctatacatctttgagtaagtggaaaattgaagaagatagactagtggggactgta
acagttcccttagcaatcggtgtagtaggtggctcaattaaggctcgtcgagacgttcaa
caaagctttagtttattaggtaatatatctgccaagcaactagcagaagttattgcgaca
actggcttagcaaataacttttcagctcttttagcaatttctactaagggaattcaagct
gggcatatgaaattgcaggcgagaaatttagtagcaaccttaaaagctagtgaaggtgaa
aaagcaatagttttaaaaaaattgcaggaaagtaaaaaatatactcaagaagcagctttt
gaatttttaagcgaaataagaaaggatcaaaaataa

DBGET integrated database retrieval system