KEGG   Lactobacillus johnsonii NCC 533: LJ_0108Help
Entry
LJ_0108           CDS       T00158                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00473  D-Alanine metabolism
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LJ_0108
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0108
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LJ_0108
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0108
Enzymes [BR:ljo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LJ_0108
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Precursor biosynthesis
  Amino acid ligase
   LJ_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST RimK GARS_N
Motif
Other DBs
NCBI-ProteinID: AAS08090
UniProt: Q74LS5
Position
129182..130267
Genome map
AA seq 361 aa AA seqDB search
MTDKIKVGLIFGGNSSEYEVSIMSAHNIYEEIDTNKFDVYPMWITNDGYLADDADSRKVL
DNPKMEVANPHKVANISNIIELKDRPEIDVFFPIVHGNLGEDGCLQGLFRVLDKPFVGDD
VLAAAVTMDKEMTKILAQRAGVPVAKWIAVKRFEYNDPDNEKLDYEYVASQLGSDLFVKP
SNQGSSVGVSHVTNEKEYKVALAEAFKYDDKVLVEETVHGTEVETAVLGNDKPIVAGVGQ
IINAKDSFYTYENKYDDDSTSTLEIPAKLPEGIVETVRKNALKVFQATECSGLARIDSML
RSEDNEVVLTEVNALPGFTNISMYPKLFEEIGIPYTDLITKLIDYAMERYDHKKTLLHKH
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaattaaggtaggtttgatcttcggtggaaattcttcagaatatgaagtt
tctatcatgtctgcccacaacatttatgaagaaattgatactaataaatttgatgtttat
ccaatgtggattactaacgatggatacttagctgatgatgcagattctcgcaaagtatta
gataatcctaaaatggaagtagctaatcctcataaagtagctaatatttctaacattatt
gaattaaaagatcgtcctgaaattgacgtatttttcccaattgtacacggaaacttaggt
gaagatggttgtttacaaggactatttagagttttagataagccatttgttggagacgat
gttttagcagcagctgtaacgatggataaggaaatgactaagatcctcgctcaacgtgct
ggtgttcctgtagcaaaatggattgcagttaagcgttttgaatataacgatccagataac
gagaagttagactatgaatacgtagctagccaattgggatcagatttatttgttaagcca
tcaaaccaaggctcttcagttggtgtaagtcatgttactaacgaaaaagaatataaggtt
gctttagctgaagcctttaaatacgatgataaggttttagttgaagaaactgttcatggt
actgaagtagaaactgctgttttaggcaatgataaaccaatcgttgctggtgttggtcaa
attattaacgcaaaagattcgttctatacctatgaaaataagtatgatgatgactcaaca
tcaactttagaaattcctgctaagcttcctgagggaattgttgaaacagttagaaagaat
gccttaaaggtgttccaagcaactgaatgtagcggcttggctcgtatcgattcgatgctt
cgtagtgaagataatgaagttgttctaacagaagtaaatgctcttcctggtttcactaat
attagtatgtatcctaagttatttgaagaaattggaattccatacactgacttaattact
aaattaattgattacgcaatggaacgctacgatcataagaagactttgttacataaacat
gattaa

DBGET integrated database retrieval system