KEGG   Lactobacillus johnsonii NCC 533: LJ_0483Help
Entry
LJ_0483           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LJ_0483
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     LJ_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAS08475
UniProt: Q74KU4
Position
527983..528606
Genome map
AA seq 207 aa AA seqDB search
MDTLLFATNNKNKAREVEEALKKINFPIHVITNQDLTDPPHVLETGTTFLANAKLKAHKM
AEFSNLPTLADDSGLSVDKLNGAPGVHSARYGGEAHNDALNNAKLLAELGGVPREKRQAT
FHTTMVVSWPGRFDDDLVTQGEIRGEILTYPRGDGDFGYDPLFFVPDKGKTFAEMTVDEK
NAISHRGQALRKLLAELPTWWKKMENE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggatactttattatttgcaactaacaataaaaataaggctagagaagttgaagaggcc
ttaaagaaaataaattttcccattcatgtaattactaatcaggacctaactgatcctccc
catgttctagaaactgggacaacatttttagctaatgcaaaactaaaagctcataaaatg
gcggagttcagtaatttaccaactcttgctgatgattcaggtttatcagttgataaatta
aacggagctcctggagttcattctgctcgctacggaggcgaagctcataatgatgcctta
aataatgcaaaattattggctgaactaggcggtgttccccgagagaaaagacaagctact
tttcatacaactatggtagtttcgtggccaggtagatttgatgatgatttagtaacacaa
ggtgaaattagaggcgaaattttaacttatccgcgaggggatggagattttggctatgat
ccacttttctttgttcctgataaggggaagacatttgctgaaatgacagtagatgaaaaa
aatgctatttctcaccgtggccaagctttaagaaaattacttgctgagctgccaacttgg
tggaaaaaaatggaaaatgaataa

DBGET integrated database retrieval system