KEGG   Lactobacillus johnsonii NCC 533: LJ_1608Help
Entry
LJ_1608           CDS       T00158                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00900  Terpenoid backbone biosynthesis
ljo01110  Biosynthesis of secondary metabolites
ljo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJ_1608
Enzymes [BR:ljo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LJ_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AAS09378
UniProt: Q74IG0
Position
complement(1482663..1483898)
Genome map
AA seq 411 aa AA seqDB search
MKLEESSKKKFYQWLPEERRVFLTEKGIKLSEIESETLERLDKLSENVIGQVRLPLGVLP
KLIVNGKDYQVPMAVEEPSVVAAANHAAKIFNQNGGAVADSRRNGIYGQIVLEVTDNFDL
TKFTTEFPQLISLANKKFVSLVKHGGGVRKIEASQKENLVFLRVLVDPAEAMGANKTNAI
LEFLGNELEKQPDIEQTLYAILSNYPTQLTSAKVSLSIDSVGGLKVAKKIALLSKIGQTD
IYRAVTNNKGIMNGIDSVLVATGNDYRGVEAATAVWANKNGAYTSLSKWKIEEDRLVGTV
TVPLAIGVVGGSIKARRDVQQSFSLLGNISAKQLAEVIATTGLANNFSALLAISTKGIQA
GHMKLQARNLVATLKASEGEKAIVLKKLQESKKYTQEAAFEFLSEIRKDQK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagaagaatcatctaaaaagaaattttatcaatggttaccagaggaaagaaga
gtctttttaactgaaaaaggaattaaactaagtgagattgagtctgaaactttggaaaga
ctagataaacttagtgaaaatgtaattggtcaagtccgtcttcctcttggtgtgcttcct
aagttaatagttaacgggaaagattatcaagtaccaatggccgtagaagaaccatcggtt
gttgcagcagcaaaccatgcagctaaaatttttaatcaaaatggtggagcagtagctgat
agtagacgaaatggaatatatggtcaaattgttttagaggtaactgataattttgattta
actaagtttactactgaatttcctcaattaattagcttagctaataaaaaattcgttagc
ttagtcaagcatggtggaggagttcgtaaaattgaagcttctcaaaaagaaaatttagtt
tttcttagagttttggttgacccagcagaagctatgggagctaataaaacaaatgctatt
ttagaatttttaggaaatgaattagagaagcagccagatattgaacaaactctgtatgca
attttgtctaattatcctacgcaattgactagtgctaaagtaagtctttcaattgacagt
gtaggaggattaaaagttgctaaaaagatagctttattgagtaaaataggacaaactgat
atttaccgggcagtgactaataataaaggaattatgaatggtattgatagtgtattggtt
gcaactggtaatgattatcgtggagttgaagcagcaactgctgtttgggctaataaaaat
ggtgcctatacatctttgagtaagtggaaaattgaagaagatagactagtggggactgta
acagttcccttagcaatcggtgtagtaggtggctcaattaaggctcgtcgagacgttcaa
caaagctttagtttattaggtaatatatctgccaagcaactagcagaagttattgcgaca
actggcttagcaaataacttttcagctcttttagcaatttctactaagggaattcaagct
gggcatatgaaattgcaggcgagaaatttagtagcaaccttaaaagctagtgaaggtgaa
aaagcaatagttttaaaaaaattgcaggaaagtaaaaaatatactcaagaagcagctttt
gaatttttaagcgaaataagaaaggatcaaaaataa

DBGET integrated database retrieval system