KEGG   Lactobacillus johnsonii NCC 533: LJ_1609Help
Entry
LJ_1609           CDS       T00158                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00071  Fatty acid degradation
ljo00072  Synthesis and degradation of ketone bodies
ljo00280  Valine, leucine and isoleucine degradation
ljo00310  Lysine degradation
ljo00362  Benzoate degradation
ljo00620  Pyruvate metabolism
ljo00630  Glyoxylate and dicarboxylate metabolism
ljo00640  Propanoate metabolism
ljo00650  Butanoate metabolism
ljo00900  Terpenoid backbone biosynthesis
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
ljo01130  Biosynthesis of antibiotics
ljo01200  Carbon metabolism
ljo01212  Fatty acid metabolism
ljo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LJ_1609
   00630 Glyoxylate and dicarboxylate metabolism
    LJ_1609
   00640 Propanoate metabolism
    LJ_1609
   00650 Butanoate metabolism
    LJ_1609
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LJ_1609
   00072 Synthesis and degradation of ketone bodies
    LJ_1609
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LJ_1609
   00310 Lysine degradation
    LJ_1609
   00380 Tryptophan metabolism
    LJ_1609
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LJ_1609
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LJ_1609
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJ_1609
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljo04147]
    LJ_1609
Enzymes [BR:ljo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LJ_1609
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LJ_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF543
Motif
Other DBs
NCBI-ProteinID: AAS09379
UniProt: Q74IF9
Position
complement(1483876..1485042)
Genome map
AA seq 388 aa AA seqDB search
MLQDVYIVGMNRIPFGKYRGFYKDKSAVDLGVLALKGLLKKNIVPQDKIDSILVGNVLSA
GLGQNVARQIALKSGLPESVVGTSVDDVCGSSLKALRFAQGQMLLGDSQIAIVGGAESMT
NAPLLLDKSKKHDENPAYQDSLMIDGIGDAYSRKPMGITAENVADKYHITRQDMDEFARD
SHAKAYAAQENDWFKEEYAPIELDGHVLDHDETIRPDSSLEALGQLKPVFKENGRVTAGN
SSPLTDGASMLLLSNQQKLDELNLTPLAYLGAYAEIGCDPAYMGYAPYFAIKKLLTKTNS
TIEDYDLIEINEAFAAQAYAVARDLNIPKEKLNIAGGAISLGHPLGATGTRLVMSAVNSL
RKINGRRAIVSLCIGGGQGIAYEIRRII
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaggatgtttatatagtaggaatgaatcgaattccttttggtaagtatcgtgga
ttttataaggataaaagtgctgttgacctaggagtgttagcacttaagggattattgaaa
aagaatattgttccacaagataaaatagatagcattttggtgggaaatgtattaagtgct
gggctaggtcaaaatgtcgctcgacaaatagctttaaaatcaggtttacctgaatctgta
gtgggtactagcgtagacgacgtttgtggttcaagtttaaaggcattacggtttgctcaa
ggtcaaatgctcctaggagattctcaaattgcaattgtaggtggggcagaaagtatgaca
aatgcaccacttttacttgataaaagtaaaaagcatgatgaaaatccagcatatcaagat
agcttaatgatagatggaattggggatgcttattcgagaaagccgatgggaattacagct
gagaatgtagctgataaataccatattacgcgtcaagatatggatgaatttgcacgtgat
tctcatgccaaggcttatgcagctcaggagaatgactggtttaaggaagagtatgcacca
attgaactcgatggtcatgttcttgatcatgatgaaaccattcgaccagattctagttta
gaagccctaggtcaattaaaacctgtatttaaggaaaatggacgagttacggctggcaat
tcttcaccgttaactgatggtgcaagtatgttgttattatctaatcaacaaaaattagat
gaattaaatttaactccattagcatacttgggtgcctatgcagaaattggctgtgatcct
gcttatatgggatacgcaccatattttgctattaaaaaattacttacaaaaactaatagc
acaattgaggattatgatctaattgaaattaatgaggcctttgcagctcaagcatatgct
gtagcccgtgatctaaatattccaaaagaaaaattaaatatcgctggaggagcaattagt
ttaggacatccgcttggtgcaaccggtacgcgcttagtaatgagtgcagtaaacagtttg
cgtaaaattaatggtcgaagagcaattgtatctctatgtattggcggtggccaaggaatc
gcatatgaaattagaagaatcatctaa

DBGET integrated database retrieval system