KEGG   Lactobacillus johnsonii NCC 533: LJ_1782Help
Entry
LJ_1782           CDS       T00158                                 

Definition
(GenBank) D-alanyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00473  D-Alanine metabolism
ljo01100  Metabolic pathways
ljo01503  Cationic antimicrobial peptide (CAMP) resistance
ljo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LJ_1782
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJ_1782
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LJ_1782
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ljo01504]
    LJ_1782
Enzymes [BR:ljo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LJ_1782
Antimicrobial resistance genes [BR:ljo01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LJ_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding RAG1
Motif
Other DBs
NCBI-ProteinID: AAS09727
UniProt: P61399
Position
complement(1900702..1900941)
Genome map
AA seq 79 aa AA seqDB search
MDTKQAVLDILNELTGEDLSDQMDENIFENGLLDSMATVQMLLELQDKCDVTAPVSEFHR
EDWDTPNKIIAKVESLRNE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagcaagctgttttagatattttaaatgaattaactggtgaagatttaagt
gaccaaatggatgaaaacatttttgaaaatggtttgttagattccatggcaactgttcaa
atgttacttgaattacaagacaagtgtgatgtaactgcaccagtatcagaatttcaccgt
gaagattgggatactccaaacaaaatcattgcaaaggtagaaagcttaagaaatgagtaa

DBGET integrated database retrieval system