KEGG   Lactobacillus kefiranofaciens: WANG_1021Help
Entry
WANG_1021         CDS       T01526                                 

Definition
(GenBank) Acetyl-coA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
lke00071  Fatty acid degradation
lke00072  Synthesis and degradation of ketone bodies
lke00280  Valine, leucine and isoleucine degradation
lke00310  Lysine degradation
lke00362  Benzoate degradation
lke00620  Pyruvate metabolism
lke00630  Glyoxylate and dicarboxylate metabolism
lke00640  Propanoate metabolism
lke00650  Butanoate metabolism
lke00900  Terpenoid backbone biosynthesis
lke01100  Metabolic pathways
lke01110  Biosynthesis of secondary metabolites
lke01120  Microbial metabolism in diverse environments
lke01130  Biosynthesis of antibiotics
lke01200  Carbon metabolism
lke01212  Fatty acid metabolism
lke02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WANG_1021
   00630 Glyoxylate and dicarboxylate metabolism
    WANG_1021
   00640 Propanoate metabolism
    WANG_1021
   00650 Butanoate metabolism
    WANG_1021
  Lipid metabolism
   00071 Fatty acid degradation
    WANG_1021
   00072 Synthesis and degradation of ketone bodies
    WANG_1021
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WANG_1021
   00310 Lysine degradation
    WANG_1021
   00380 Tryptophan metabolism
    WANG_1021
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WANG_1021
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WANG_1021
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WANG_1021
Enzymes [BR:lke01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WANG_1021
Exosome [BR:lke04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WANG_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEG40716
Position
complement(1119161..1120324)
Genome map
AA seq 387 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKNVTATDLGVMALKGTLAAGNIDPQDVEALFMGNVLSSG
LGENVARQVALYSGMRQESAAVTINEVCGSSIKAVRLAQGQMELGDLGLVAVGGSESMTR
APYLVKKEDKDHPDKHLISSIINDGLMDAFSNEHMGMTAENVAERYHVSRQEMDKFSLRS
HQKATAAVKSGFFKNEILPIELNGKKLDHDELIRPDTTLEALGKLKPVFKENGLVTAGNS
SPLTDGASMLVLATKEKVTELGLKPIAKLGNFTEAGFDPAYMGYTPYFAVKKMLQNTGRS
ITDYDIVELNEAFAAQSVAVARDLAIPAERLNIMGGAIALGHPLGATGTRLIASAISGLK
YRNAQRALVTLCIGGGQAIAYEIENVE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttatattgtggcagccaagagaacgccatttggcaaatatcgtggcttt
tttaagaatgtgacggcaacagacttaggagtaatggcgcttaaaggcaccttagccgca
ggcaatattgatccgcaagatgtagaagcattatttatggggaacgtgcttagtagcggt
ttaggcgaaaatgttgcgcggcaagtagcactttactcagggatgaggcaagaatccgct
gcagtgacaattaatgaagtgtgtggctctagcataaaggctgttcgtttagctcaagga
caaatggagctgggcgacctaggcttggtagctgttggtggcagcgaaagcatgactcgg
gcaccttatttagtgaaaaaagaggataaggatcacccagacaagcacttaattagttca
ataatcaatgatggtttaatggatgctttttctaatgagcatatgggaatgacggctgaa
aatgtagctgagagataccatgtttctcgtcaggaaatggacaaattcagcttgcgttca
catcaaaaggcaactgcagctgttaaatcgggcttttttaaaaatgaaattttgccaatt
gaacttaatggaaaaaaattggatcatgatgagctgattcgcccagatactacattagaa
gcattaggtaaactaaagccggtgtttaaggagaatggcctagtgactgcaggtaattcc
tcgcctctaacggatggggctagcatgttagttctagctaccaaggaaaaagtgactgaa
ttagggttaaaacctattgccaagttaggcaactttactgaagctggctttgatcctgca
tatatgggttatacgccatattttgccgtaaaaaaaatgctgcaaaatacgggtcgttcg
attaccgattatgatattgtggaattaaatgaagcctttgccgctcaaagcgtagcagta
gctcgtgatttagctattcctgctgagcgcttgaacatcatgggtggagcgattgcgcta
ggtcacccattaggagcaactgggacgcgtttaatcgcttctgcaattagcgggttaaag
tatcgcaatgctcagcgcgcgctggttaccttatgtattggtggcggacaggcaattgct
tatgaaatcgaaaatgtagaatga

DBGET integrated database retrieval system