KEGG   Leuconostoc kimchii: LKI_05215Help
Entry
LKI_05215         CDS       T01233                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lki  Leuconostoc kimchii
Pathway
lki00450  Selenocompound metabolism
lki00970  Aminoacyl-tRNA biosynthesis
lki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lki00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LKI_05215
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LKI_05215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lki01007]
    LKI_05215
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lki03016]
    LKI_05215
Enzymes [BR:lki01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LKI_05215
Amino acid related enzymes [BR:lki01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LKI_05215
Transfer RNA biogenesis [BR:lki03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LKI_05215
 Prokaryotic type
   Other AARSs
    LKI_05215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ADG40584
UniProt: D5T2T5
Position
1013125..1015236
Genome map
AA seq 703 aa AA seqDB search
MSEPNNVLFNTANLTDSAVVYDKFSKAEQQFSVKKDKTFYITTPIYYPSGKLQLGNTYTT
VLADAAARYHRLLGEDVHFLTGTDEHGLKIQQKAQAAGISEIDYLDGMAKDIKTLWSLMD
ISYDDFIRTTEDRHEKAVQKIFTTLLENDDIYKGEYEGWYSVSDEEYFTESQLAEVFRDE
DGNMIGGKAPSGHEVELVKEEAYFFKMSKYADWLLEYYKSHPEFIQPEARMNEMINNFIA
PGLEDLAVTRASVDWGIPVPGDEKHVIYVWIDALSNYITALGYDSDNTEAFDKFWPANVQ
LVGKEIVRFHTIYWPIMLHALGLELPKSVIGHGWLVMKDGKMSKSKGNVIYPEVLEARYG
LDAVRYYLLRAMPFGNDGVFTPEDFVARVNFDLANDLGNLLNRTVAMINKYEGGVVPQLQ
TGQTDFDEDLVRTVEEAIVSYNQNFKALRTADALENVWVIIRRANKYIDETQPWVLAKDD
TQKAILSNVMAHLAGALRIVAVLLQPVLTQAPRKIYEQLGFEYPENGVRIAGLTFGQLPT
GGKVVKKGEPIFPRQNVEEEVTFISGLVSKDTKGKGRAVKEEAKKTAVTETSERDLITYD
DFAKIEILAAKIVSGEIVEKSEKLLKFTLDDGSGKPRQILSGIRKWYADPTVLVGKTVAI
VANMKPRKMAGELSEGMILSAEKNDIVTVTILPDSIEPGSGIE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccaaataatgtcctttttaacacagctaatcttacagattcggcagtcgtt
tatgataaattttcaaaagcagaacaacaattttctgtcaagaaagataagactttctat
attacaacaccaatttattatccatctggtaaattacaattagggaatacctatacaaca
gttttagcagatgctgctgcacggtaccatcgtttacttggtgaagacgttcattttttg
acaggtacggatgaacacggacttaaaatacaacaaaaagcgcaagctgcaggtatatct
gagattgattacttagatggtatggctaaagatattaaaacactttggtctttgatggat
atttcatatgatgactttattcgtacaacagaagatcgtcatgaaaaagcagttcaaaaa
atatttaccacattacttgaaaacgatgacatttataaaggtgaatatgaaggttggtat
tctgtttctgatgaggaatacttcacagaatcacaactagctgaagtatttcgggatgaa
gatggtaatatgattggtggtaaggcaccatcaggtcatgaagttgaattagttaaagaa
gaagcatacttcttcaaaatgagtaagtatgccgattggttattagaatactacaagtca
catccggaatttattcaaccagaagcgcgtatgaacgaaatgattaataatttcatcgca
ccaggattggaagatctagccgtgacacgtgcttctgtggattggggaattccagtacca
ggagatgaaaagcatgtcatttatgtctggattgatgccttatcaaactacatcacagcg
cttggttatgactctgacaatacggaggcatttgataaattctggccagccaatgtccaa
ttagttggaaaagaaattgtgcgtttccatacgatttattggccaattatgttgcatgct
ttaggtcttgagttaccaaaatcggttattggccatggttggcttgtcatgaaagacggt
aaaatgtctaagtctaagggaaatgtgatttatcccgaagtcttagaagcgcgttatggt
ctggatgctgtacgctattacttattgcgtgccatgccatttggcaatgatggtgtcttc
acacccgaagacttcgtggcgcgtgtgaactttgacttagctaatgatttgggtaactta
ttaaaccgtacagtggcgatgattaataagtatgaaggcggcgttgtaccacaattgcaa
actggccaaactgactttgacgaagatttggtacgtacggtggaagaagccatcgtgtct
tataatcaaaactttaaagcactgcgaacagctgatgctttggaaaatgtttgggtcatc
attcgacgtgctaataagtacatcgatgaaacacaaccatgggttttggctaaagatgac
acgcaaaaggctatactatcaaatgttatggcacatttagcaggtgccttgcgtattgtt
gctgtactgctacaaccagtgttaacacaagcaccacgcaaaatatacgaacaacttggt
tttgagtatcctgaaaacggcgtacgcattgctggattaacatttggacagttgccaact
ggtggcaaagttgttaaaaagggtgaacccattttcccacgtcaaaatgttgaagaagaa
gtgacctttatttccggattggtatcaaaagacacaaagggtaagggtcgtgcagtgaaa
gaagaagcgaaaaagacggcggtgacagaaacgtcagaacgtgacttgattacttatgat
gattttgcaaaaattgaaattttagcagctaaaattgtgagtggggaaattgttgaaaag
tctgaaaagttactcaagtttacgcttgatgatggttcaggtaaaccacgacaaattcta
tcaggtattcgtaaatggtacgctgatccaactgtattagttggcaagacagtagctatc
gtggctaacatgaagccacgtaaaatggcaggtgagttgtcagaggggatgattttatcg
gctgagaaaaatgatattgtcacagtgactattttgccagattcaattgaaccgggctca
ggcattgagtaa

DBGET integrated database retrieval system