KEGG   Leuconostoc kimchii: LKI_05830Help
Entry
LKI_05830         CDS       T01233                                 

Definition
(GenBank) sugar phosphatase of the HAD superfamily (putative)
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lki  Leuconostoc kimchii
Pathway
lki00627  Aminobenzoate degradation
lki01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lki00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LKI_05830
Enzymes [BR:lki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LKI_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Amidase_2
Motif
Other DBs
NCBI-ProteinID: ADG40706
UniProt: D5T357
Position
complement(1134621..1135394)
Genome map
AA seq 257 aa AA seqDB search
MSQYKTYFIDLDGTIYQGKIKYPSGKRFIDRLKKAQIPYLFVTNNSTKSAIEVAKNLTEN
HDIATTPDQIYTSAMATADYLKATVAPHATVYVLGEDGLQEAIVNAGFEVVNRSDVDVVV
VGLDRNITYDKLTVATLAIQSGAQFIATNSDTNLPTERGMTPGAGAIIAAVKTATQIEPL
VIAKPELPIMTGALQRMAVQKSDVVMVGDNYQTDILAGINSNIDTLLVYSGVSTHDQINR
VLKKPTHEVETLDDWII
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtataaaacttattttattgaccttgatggtacgatttaccaaggtaaaatc
aaatatccatcaggaaaacgctttatagatcgacttaaaaaggcacaaattccgtacctc
tttgtgacgaacaattcaacaaaaagtgcgatagaagtcgctaaaaatcttacagaaaat
catgatattgcaacaacacctgatcagatttacacaagtgccatggcaactgccgactat
ttaaaggccacagttgcaccacacgccaccgtttacgtacttggcgaagacggcttgcaa
gaggccatcgtcaatgccggttttgaagttgttaatcgtagtgatgttgatgtcgtcgtt
gttgggttagatcgtaatataacttatgataaactaacagtagcaaccttagcaattcaa
tctggtgcacagttcattgcaacaaatagtgacacaaatttgccaaccgaacgtggtatg
acaccaggcgctggcgccatcattgctgcagtaaaaacggcaacacaaatcgaacccctt
gttattgctaaaccggagctgccaattatgactggcgccctgcaacgtatggcggtacaa
aaaagtgacgtcgttatggttggtgataactaccaaaccgatattttagccggcattaat
agtaatatcgacacgctactcgtttattcaggtgtttcaacacatgaccagattaatcgt
gtcttaaaaaagccaacccatgaagttgagacacttgatgactggatcatataa

DBGET integrated database retrieval system