KEGG   Leuconostoc kimchii: LKI_05860Help
Entry
LKI_05860         CDS       T01233                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lki  Leuconostoc kimchii
Brite
KEGG Orthology (KO) [BR:lki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lki03009]
    LKI_05860
Enzymes [BR:lki01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LKI_05860
Ribosome biogenesis [BR:lki03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LKI_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADG40712
UniProt: D5T363
Position
1140238..1141158
Genome map
AA seq 306 aa AA seqDB search
MAAIWRYQMLVTDVLSGRTIKQLLVGWLIPQRVRGALRIKKNYRVNGQEVPTSYNLQVND
ILSLIFDESDFRTGVSHYAPNSEKVVDIVFENDDLVVVNKPAGMKMHPHSETEDDTLLNY
VAANFLARSVLSAGVPAKPYMVHRIDRETSGAVIIAKNPVVVPILNRLLFEKNIQRTYLA
WVDGNMSAKAGVIDAPIGIDPQNNRKRLVDGIDAQSAKTHWTRVHVVYQHTLLRLQLDTG
RMHQIRVHLASMGHPIVGDSLYASKVITTRMLLHAVSVVIPLPFKNKTVVISCPVPNDFP
RQLLST
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaatatggcgttaccaaatgctcgtgacggacgttttatctgggcgaacaatt
aagcagttacttgtgggctggttaataccacagcgtgtacgcggcgcattacgtattaag
aaaaactatcgggttaatggtcaagaggtacctacgagctataatttgcaggtaaatgat
attttgtcattgatatttgatgagtcagattttcgtacaggcgtttcacattatgcgcca
aatagcgagaaggttgttgatattgtgtttgaaaatgacgatttagtcgttgttaataaa
cctgcaggcatgaaaatgcacccgcattctgaaacagaggatgatactttattaaattat
gtggcggctaattttttagcacgaagtgttttgagcgccggtgtgccggcgaaaccctac
atggttcatcgtattgaccgggaaacatcgggtgcggttattattgctaaaaatccagtt
gtcgtaccaatattaaatcgattattgtttgaaaaaaatattcaacgtacttatttagca
tgggttgatgggaatatgtcggcaaaagcaggtgttattgatgcgccaataggcattgat
cctcaaaataaccgtaagcgccttgtggatggtattgacgcgcaatcagcaaaaacacat
tggactcgtgtacatgttgtttatcaacatactttgttacgattgcagttagatacgggg
cgtatgcatcaaattcgtgtgcatttggctagtatgggtcatccgatcgtaggtgattcc
ttatatgctagtaaagtgataacaacgcgaatgctgttgcatgcggtatcagtcgtcata
ccgttgccctttaaaaataaaacagttgttattagttgccctgtaccaaacgattttcca
cgccagttattatccacataa

DBGET integrated database retrieval system