KEGG   Leuconostoc kimchii: LKI_10090Help
Entry
LKI_10090         CDS       T01233                                 

Definition
(GenBank) probable zinc-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lki  Leuconostoc kimchii
Pathway
lki00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LKI_10090
Enzymes [BR:lki01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LKI_10090
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LKI_10090
    1.1.1.-  
     LKI_10090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C Pyr_redox_2 Pyr_redox 2-Hacid_dh_C ADH_N_assoc TrkA_N Titin_Z UDPG_MGDP_dh_N PrmA AlaDh_PNT_C PS-DH FtsJ
Motif
Other DBs
NCBI-ProteinID: ADG41557
UniProt: D5T572
Position
1986286..1987335
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHDVKDVRVEDVELKPAKDNEVVVRVSYAGICGSDLHEYLEGPVFIPVDKPDELT
GGQAPLTMGHEFSGVIEKIGTDVTHFKVGDHVSINPTVTKGVSSDDLDVYDGYSFIGLST
DGGFTSFVNVPEENLYHLPEDFSLKLAATIEPTAVAVQAIKEGGLKFGEKVVIFGAGPIG
VLVAAAAKAAGATKIIAVDLSEVRLNKALEMGATDVINPSQVSDTIAAIKEIIPNGADVS
FEVAGVQPTFEQAIDATRARGTVVIVSIFAKPIAFDPMQLTNAGVKLTSTIAYSKETFEQ
TVELVSSGQIDVKPVITDVIELDNILSDGFESLTHDKSQAKILVDLTKE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggcatgatgttaaggatgttcgcgtggaagatgttgagctgaaa
ccagctaaggataatgaagtagttgtccgcgtttcttatgcaggtatttgtggtagtgat
ttgcatgaataccttgagggaccagtatttattcctgttgataaaccggatgaattgact
ggtggtcaggcacctctgacaatgggtcatgaattctcaggcgtgattgaaaagattggt
actgacgtgacacactttaaagtgggagatcatgtgtcaattaacccaactgtaaccaag
ggtgtatcatcagatgatttagatgtttatgatggttatagctttatcgggttgagcaca
gatggtggatttacatcgtttgtcaatgtgccagaagaaaatttgtatcatttgccagaa
gatttttcattgaaattggctgctacaattgagccaacagcggttgcagtgcaagctatt
aaagaaggcggcctcaaatttggtgaaaaggttgttatatttggtgctggccctataggt
gttttagtagcagccgccgcaaaagcagctggtgcgactaaaattattgcggttgatttg
tcagaagtgcgtcttaataaagcccttgagatgggtgctactgatgtgataaatcctagc
caagttagtgatacgattgctgccattaaagaaattattccaaatggtgctgatgtttct
ttcgaagttgcaggcgtacaaccaactttcgaacaagctatcgatgcaacacgcgcacgt
ggtacagtagttattgtatcaatatttgctaagccaattgcctttgacccaatgcagtta
acaaatgctggtgttaaattaacatcaacaattgcttattcaaaagagacattcgaacaa
actgtcgaacttgtcagcagtgggcagattgatgtcaaacctgtcattactgatgttatt
gagttagataatattttgtcagatggttttgaatcactgacgcatgacaaatcacaagct
aaaattttagttgatttaacaaaagaataa

DBGET integrated database retrieval system