KEGG   Lactobacillus koreensis: ABN16_04035Help
Entry
ABN16_04035       CDS       T03995                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
lko  Lactobacillus koreensis
Pathway
lko00511  Other glycan degradation
lko00600  Sphingolipid metabolism
lko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    ABN16_04035
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ABN16_04035
Enzymes [BR:lko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ABN16_04035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 Alpha-L-AF_C CagS
Motif
Other DBs
NCBI-ProteinID: AKP64244
Position
complement(898572..899906)
Genome map
AA seq 444 aa AA seqDB search
MTTWIESTPNNYLQEKTPTVANVAASADLQLTGKGLQKLRGFGGCFNELGYLPLSKLASD
KQQEIYKDLFSPDELNFTFNRTPIGANDFAESWYSYDETDGDYDLKEFSVDHDKQTLIPY
INNAKKYQPNLQLFASPWTPPTWMKFPKVYNFGRIVMTPENLQAYANYFVKYIRAYEKQG
IHIERVCPQNEVFADQKFPSCLWSSDDLKVFIRDYLGPTFEKEGIDTEIFLGTLNGPEDM
SFNASGIKLDNYNRYVDNILFDDDARKYIKGIGYQWAGQNAIERTHSSWPEIELVQTESE
CGYGDNSWVYAEYIFHLVNHYFTAGATAYTYWNIILGDSISTWGWHQNSMFSIDSKTQAV
TRNPEYYVMRHYAHYVKPGAQVLETTGHFNSMGKAFRNPDGQLVVVVQNALERALPFTFA
DPEDASKSVEATLAPNSFNTFVID
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctggattgaaagtacaccaaataattatttacaagaaaaaacaccaactgtc
gcgaatgtggcggcttccgcggatctacaattgaccgggaagggactacaaaagttacgg
ggcttcggtggttgctttaatgaactgggttacttgccattgagtaagctggccagtgat
aagcaacaggaaatttataaagatttgttctcaccagacgaattgaatttcaccttcaac
cggacaccaattggtgctaacgatttcgcggagtcttggtatagttacgatgaaaccgat
ggcgattatgacttgaaagaattctccgttgaccatgataagcaaacgttgattccatac
atcaataatgccaaaaagtatcaacccaacctgcaactgtttgctagtccttggacgcca
ccaacctggatgaagttccctaaggtgtataactttggtcgcattgtgatgacgccggaa
aacttacaagcctacgcaaactacttcgttaagtacattcgtgcttacgaaaaacagggc
attcacatcgaacgcgtttgccctcaaaatgaagttttcgcagatcagaaattcccatcc
tgcctgtggagcagtgatgacttgaaggtcttcattcgcgattacctcggaccgaccttt
gaaaaggaaggcattgacacagaaatcttcttgggaacgttaaatggtccggaagacatg
tcattcaacgcgtctggcatcaagttggacaactacaaccggtacgttgataacatcttg
ttcgatgatgacgcacggaagtacatcaaggggattggctaccagtgggctgggcaaaat
gctattgaacgaactcacagctcatggccagaaattgaactggttcaaacggaatcagaa
tgtggctatggtgacaatagttgggtatatgccgaatatattttccatctggtcaaccac
tacttcacggctggcgctacggcttacacgtactggaacatcattttaggtgactctatt
agtacttggggctggcatcaaaattcaatgttctcaattgattccaagactcaagcggta
acccgcaacccagaatactacgtgatgcgccactatgcgcactacgttaagccaggtgcc
caggttctggaaacaacagggcacttcaactcgatgggaaaggctttccgcaacccagat
gggcagttagtggtcgtcgttcaaaatgctttggaacgggcattaccattcacgtttgct
gatccagaggatgcctcaaagagtgttgaagctactttagcacccaactcgtttaacacg
tttgtaattgattaa

DBGET integrated database retrieval system