KEGG   Lactobacillus koreensis: ABN16_05920Help
Entry
ABN16_05920       CDS       T03995                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lko  Lactobacillus koreensis
Pathway
lko00071  Fatty acid degradation
lko00072  Synthesis and degradation of ketone bodies
lko00280  Valine, leucine and isoleucine degradation
lko00310  Lysine degradation
lko00362  Benzoate degradation
lko00380  Tryptophan metabolism
lko00620  Pyruvate metabolism
lko00630  Glyoxylate and dicarboxylate metabolism
lko00640  Propanoate metabolism
lko00650  Butanoate metabolism
lko00900  Terpenoid backbone biosynthesis
lko01100  Metabolic pathways
lko01110  Biosynthesis of secondary metabolites
lko01120  Microbial metabolism in diverse environments
lko01130  Biosynthesis of antibiotics
lko01200  Carbon metabolism
lko01212  Fatty acid metabolism
lko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABN16_05920
   00630 Glyoxylate and dicarboxylate metabolism
    ABN16_05920
   00640 Propanoate metabolism
    ABN16_05920
   00650 Butanoate metabolism
    ABN16_05920
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABN16_05920
   00072 Synthesis and degradation of ketone bodies
    ABN16_05920
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABN16_05920
   00310 Lysine degradation
    ABN16_05920
   00380 Tryptophan metabolism
    ABN16_05920
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABN16_05920
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABN16_05920
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABN16_05920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lko04147]
    ABN16_05920
Enzymes [BR:lko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABN16_05920
Exosome [BR:lko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABN16_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III TcpA
Motif
Other DBs
NCBI-ProteinID: AKP64580
Position
complement(1304433..1305602)
Genome map
AA seq 389 aa AA seqDB search
MAEEVVIVSAVRTPIGKFGKNFRSVSAVQLGTLAAKAAIERSGLTPAMIQQTIFGTVLQA
GQGQNVARQIELNAGIPVTSTAMTVNQVCGSSLKAIRLGQSAILLGDADAVLVGGTESMS
QAPYLSPHSRFGHKFGDMTLVDSLAKDGLVDAFNDIPMGITAENVATKYHVSREEQDAFA
LRSQQNATQAQLEHRFDAEIVPVPVGDQLITTDEAVRTTTSAAQLAALKPSFKSNGTVTA
GNAAGLNDGAAAMILMRKSTAIAANIPYLATLTGYQEAGIDPAIMGYAPVYAIQKMLDRT
HATVAGIDRFEINEAFAAQSVAITRDLKIPTHKLNVNGGSIALGHPLGASGTRIVVTLLH
ELMRSGGHRGLASMCIGGGMGIALMLERD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagttgtaattgttagcgcggtccggacccccatcggaaaattcggtaag
aatttccggtccgtttccgccgttcaactggggaccctcgctgcaaaggccgccatcgaa
cgaagtggcctcacacccgccatgattcagcagaccatcttcggtacggttctgcaagca
ggccagggccaaaacgtggctcgccaaattgaactcaacgccggtatccccgtcaccagc
accgcgatgaccgtcaatcaggtctgtgggtctagcctaaaagctattcgacttggccaa
agcgctatcctattaggtgacgccgacgccgttttagtcggtggcacggagagcatgagc
caggcgccctatttgagccctcattcacgttttggtcataaatttggtgatatgacgctg
gttgatagtttggccaaggacggcttagtagatgcgtttaacgacattcctatgggcatc
acggccgagaacgtcgcaacgaaatatcacgttagccgggaggaacaagatgcctttgct
ctccgctcacaacaaaatgcgacccaggcacagttagaacaccgctttgacgctgaaatc
gtccccgttcccgttggcgatcagctgattacaacggatgaagctgttcggacgacaacc
tccgctgcacagttggcggcgctaaagccttcatttaaatccaatggcacggtcacagcc
ggcaatgccgctgggctaaacgacggtgcagcagccatgatcctcatgcgtaaatcgacg
gccattgctgccaatatcccttacttagctacacttacaggctaccaggaagctggcatt
gatccggccatcatgggttatgcgcccgtctacgccatccaaaagatgcttgaccgcacc
cacgcgacagttgcggggattgaccgctttgaaattaatgaagcctttgccgcccaatcc
gttgcgattacccgcgacttaaaaataccgactcataaactaaacgttaacggtggcagc
atcgccctgggtcatcccctgggtgcctccggaacacgaatcgtcgtaacgttactgcac
gaactaatgcgcagcggtggtcaccgtggcctcgcctcgatgtgcatcggcggcggtatg
ggcattgcccttatgcttgaacgcgattag

DBGET integrated database retrieval system