KEGG   Lactobacillus kunkeei: APS55_01365Help
Entry
APS55_01365       CDS       T04112                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lku  Lactobacillus kunkeei
Pathway
lku00450  Selenocompound metabolism
lku00970  Aminoacyl-tRNA biosynthesis
lku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lku00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    APS55_01365
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APS55_01365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lku01007]
    APS55_01365
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lku03016]
    APS55_01365
Enzymes [BR:lku01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     APS55_01365
Amino acid related enzymes [BR:lku01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   APS55_01365
Transfer RNA biogenesis [BR:lku03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    APS55_01365
 Prokaryotic type
   Other AARSs
    APS55_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART EF-hand_7 YihI Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: ALJ30960
UniProt: A0A087EMZ4
Position
complement(245211..247247)
Genome map
AA seq 678 aa AA seqDB search
MADNNTFYVTTPIYYPSGRLHIGNSYTTIACDALARYKRAEGFDVFFLTGTDEHGLKIEE
KAESLNTTPQAYVDKMAAQIKDLWKKLDISNDKFIRTTDAQHREVVQKIFQQLLDQGDIY
LGEYSGWYSVSDEEYFTESQLAEVYKDDNGNVIGGKAPSGHEVELVNEKSYFFKMSKYAD
WLLQYYKDHPDFIQPESRMNEMINNFIKPGLEDLAVSRTSFSWGIPVKSNPEHVVYVWID
ALSNYISALGYDTDDDSLFQKFWPADVHMVGKEIVRFHTIYWPIILHALGLPLPKHVIGH
GWLTMKDGKMSKSKGNVIYPEVLAERYGLDAVRYYLLKAVPFGNDGVFTPEDFVDRINYD
LANDLGNLLNRTVSMINKYEDGVIPEFKSNFLEPDKELEALSKDVIAEYKTKMDESRFSE
ALAAVWQLVSQTNKYIDQTTPWILAKNENDGDAEKLADVMAHLAASLRVIGLLISPIMTH
APKEIFTQLGLSNQAIDLTNIAIEDLPTGGKVVAKGTPIFPRLDKEEEVDFIKNQMTKSD
KKKGRAAKEEAKKQAQVAQEGAESAADKKEIKFDTFEKVEIKVAEVKNVERVEGADKLLK
FTLDAGKEETTQILSGIAKWYPDFEKLIGKKVIIVSNLKPRKMRGQLSQGMLLSVEHDDG
NIELVTIGSQFENGATLE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacaatactttttatgttacaacgcctatctactacccatcaggacgttta
catatcgggaactcatacacaactattgcttgtgatgcgttagctcgttacaaacgtgct
gaaggttttgacgtgttcttcctaacaggaacagatgaacacggactaaaaatcgaagaa
aaggcagaatcattaaacacaactccacaagcatacgtggacaagatggctgctcaaatt
aaagacttatggaagaaattggacatctcaaacgacaagttcatcagaaccactgatgca
caacacagagaagttgttcaaaagattttccaacaattattagatcaaggtgacatttac
ctaggtgaatactctggttggtactcagtatccgacgaagaatacttcaccgaatcacaa
ttagcagaagtatacaaagacgataacggtaacgttattggtggaaaggcgccatcagga
cacgaagttgaactagtgaacgaaaagtcatacttcttcaagatgagcaagtacgctgat
tggttattacaatactacaaagatcatcctgattttattcaaccagaatcaagaatgaac
gaaatgattaataacttcatcaaaccaggtctagaagatttagctgtttctagaacatca
tttagttggggaattcctgttaaatcaaatccagaacacgtagtttacgtatggattgat
gcgctatcaaactatattagtgcattaggatacgatactgatgatgattcactattccaa
aaattctggcctgctgatgttcacatggttggtaaggaaatcgttagattccatactatc
tactggccaattatcctacatgctttaggtttaccattaccaaaacatgttattggtcac
ggttggttaaccatgaaagacggaaagatgtctaaatcaaagggtaacgttatttaccca
gaagtcttagccgaaagatacggtttggatgctgtaagatactacttactaaaggccgtt
ccatttggtaacgatggtgtattcacaccagaagacttcgttgatcgtatcaactacgac
ctagcaaacgacttaggtaacttattaaaccgtactgtttcaatgattaacaagtacgaa
gacggtgtgattccagaattcaagtcaaacttcttagaacctgataaggaactagaagca
ctaagcaaggacgttattgctgaatacaagactaagatggatgaatcacgtttctcagag
gctttagctgctgtttggcaattagtttctcaaactaacaagtacattgaccaaactaca
ccatggattttagctaagaatgaaaacgatggtgacgctgaaaagcttgctgatgtaatg
gctcatttagctgccagcttacgagtaatcggtctattaattagcccaattatgacccac
gcaccaaaggaaatcttcactcaattaggtttaagcaatcaagcaattgatttaactaac
attgcaattgaagacttaccaacaggtggcaaagtggttgctaagggaactccaatcttc
ccacgtctagacaaggaagaagaagttgactttatcaagaaccaaatgactaagtcagac
aagaaaaagggtcgtgcagccaaagaagaagctaagaaacaagctcaagttgcccaagag
ggtgctgaaagtgctgctgataagaaagaaatcaagttcgatacctttgaaaaagtagaa
ataaaagttgccgaagttaagaacgttgaacgtgttgaaggggcagacaagttattgaag
tttaccctagatgcaggtaaggaagaaactactcaaatcctttcaggaattgctaagtgg
tatcctgacttcgaaaaactaattggtaagaaagtaatcatagtttccaatttgaaacct
agaaagatgcgtggccaattgagccaaggaatgttactatctgttgaacatgacgatggc
aacattgaattagttacaattggtagccaatttgaaaatggtgccactttggaataa

DBGET integrated database retrieval system